KEGG   Homo sapiens (human): 8339Help
Entry
8339              CDS       T01001                                 

Gene name
H2BC8, H2B.1A, H2B/a, H2BC10, H2BC4, H2BC6, H2BC7, H2BFA, HIST1H2BG, dJ221C16.8
Definition
(RefSeq) H2B clustered histone 8
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8339 (H2BC8)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8339 (H2BC8)
  09165 Substance dependence
   05034 Alcoholism
    8339 (H2BC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8339 (H2BC8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8339 (H2BC8)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8339 (H2BC8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8339 (H2BC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 8339
NCBI-ProteinID: NP_003509
OMIM: 602798
HGNC: 4746
Ensembl: ENSG00000273802
Vega: OTTHUMG00000014446
UniProt: P62807 B2R4S9
Structure
PDB: 

Position
6p22.2
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccagctaagtcagctcctgctccgaagaagggttccaagaaggctgtgacc
aaggcgcagaagaaggatggcaagaagcgcaagcgcagtcgtaaggagagctactccgtg
tatgtgtacaaggtgctaaaacaggttcaccccgatactggcatctcatccaaggccatg
ggcatcatgaattccttcgttaacgacatcttcgaacgcatcgcaggcgaggcttcccgt
ctggcccactacaacaagcgctcgaccattacctccagggagatccagaccgccgtgcgt
ctgctgcttcccggagagctggccaagcacgcagtgtccgaaggtaccaaggctgtcacc
aagtatacaagctccaagtaa

DBGET integrated database retrieval system