KEGG   Homo sapiens (human): 834Help
Entry
834               CDS       T01001                                 

Gene name
CASP1, ICE, IL1BC, P45
Definition
(RefSeq) caspase 1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05164  Influenza A
Drug target
Belnacasan: D10416
Emricasan: D10004
Nivocasan: D09938
Pralnacasan: D08978
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    834 (CASP1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    834 (CASP1)
   04623 Cytosolic DNA-sensing pathway
    834 (CASP1)
   04625 C-type lectin receptor signaling pathway
    834 (CASP1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    834 (CASP1)
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    834 (CASP1)
   05133 Pertussis
    834 (CASP1)
   05134 Legionellosis
    834 (CASP1)
  09172 Infectious diseases: Viral
   05164 Influenza A
    834 (CASP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    834 (CASP1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    834 (CASP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     834 (CASP1)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   834 (CASP1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    834 (CASP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD
Motif
Other DBs
NCBI-GeneID: 834
NCBI-ProteinID: NP_001244047
OMIM: 147678
HGNC: 1499
Ensembl: ENSG00000137752
Vega: OTTHUMG00000048072
Pharos: P29466(Tchem)
UniProt: P29466 A8K249
Structure
PDB: 

Position
11q22.3
AA seq 404 aa AA seqDB search
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaaggtcctgaaggagaagagaaagctgtttatccgttccatgggtgaaggt
acaataaatggcttactggatgaattattacagacaagggtgctgaacaaggaagagatg
gagaaagtaaaacgtgaaaatgctacagttatggataagacccgagctttgattgactcc
gttattccgaaaggggcacaggcatgccaaatttgcatcacatacatttgtgaagaagac
agttacctggcagggacgctgggactctcagcagatcaaacatctggaaattaccttaat
atgcaagactctcaaggagtactttcttcctttccagctcctcaggcagtgcaggacaac
ccagctatgcccacatcctcaggctcagaagggaatgtcaagctttgctccctagaagaa
gctcaaaggatatggaaacaaaagtcggcagagatttatccaataatggacaagtcaagc
cgcacacgtcttgctctcattatctgcaatgaagaatttgacagtattcctagaagaact
ggagctgaggttgacatcacaggcatgacaatgctgctacaaaatctggggtacagcgta
gatgtgaaaaaaaatctcactgcttcggacatgactacagagctggaggcatttgcacac
cgcccagagcacaagacctctgacagcacgttcctggtgttcatgtctcatggtattcgg
gaaggcatttgtgggaagaaacactctgagcaagtcccagatatactacaactcaatgca
atctttaacatgttgaataccaagaactgcccaagtttgaaggacaaaccgaaggtgatc
atcatccaggcctgccgtggtgacagccctggtgtggtgtggtttaaagattcagtagga
gtttctggaaacctatctttaccaactacagaagagtttgaggatgatgctattaagaaa
gcccacatagagaaggattttatcgctttctgctcttccacaccagataatgtttcttgg
agacatcccacaatgggctctgtttttattggaagactcattgaacatatgcaagaatat
gcctgttcctgtgatgtggaggaaattttccgcaaggttcgattttcatttgagcagcca
gatggtagagcgcagatgcccaccactgaaagagtgactttgacaagatgtttctacctc
ttcccaggacattaa

DBGET integrated database retrieval system