KEGG   Homo sapiens (human): 83417Help
Entry
83417             CDS       T01001                                 

Gene name
FCRL4, CD307d, FCRH4, IGFP2, IRTA1
Definition
(RefSeq) Fc receptor like 4
  KO
K06727  Fc receptor-like protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    83417 (FCRL4)
CD molecules [BR:hsa04090]
 Proteins
  83417 (FCRL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig I-set Ig_4 V-set Ig_5
Motif
Other DBs
NCBI-GeneID: 83417
NCBI-ProteinID: NP_112572
OMIM: 605876
HGNC: 18507
Ensembl: ENSG00000163518
Vega: OTTHUMG00000035488
Pharos: Q96PJ5(Tbio)
UniProt: Q96PJ5
Position
1q23.1
AA seq 515 aa AA seqDB search
MLLWASLLAFAPVCGQSAAAHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEKTTWYHR
HYWGEKLTLTPGNTLEVRESGLYRCQARGSPRSNPVRLLFSSDSLILQAPYSVFEGDTLV
LRCHRRRKEKLTAVKYTWNGNILSISNKSWDLLIPQASSNNNGNYRCIGYGDENDVFRSN
FKIIKIQELFPHPELKATDSQPTEGNSVNLSCETQLPPERSDTPLHFNFFRDGEVILSDW
STYPELQLPTVWRENSGSYWCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQA
VEGEMLVLVCSVAEGTGDTTFSWHREDMQESLGRKTQRSLRAELELPAIRQSHAGGYYCT
ADNSYGPVQSMVLNVTVRETPGNRDGLVAAGATGGLLSALLLAVALLFHCWRRRKSGVGF
LGDETRLPPAPGPGESSHSICPAQVELQSLYVDVHPKKGDLVYSEIQTTQLGEEEEANTS
RTLLEDKDVSVVYSEVKTQHPDNSAGKISSKDEES
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgtgggcgtccttgctggcctttgctccagtctgtggacaatctgcagctgca
cacaaacctgtgatttccgtccatcctccatggaccacattcttcaaaggagagagagtg
actctgacttgcaatggatttcagttctatgcaacagagaaaacaacatggtatcatcgg
cactactggggagaaaagttgaccctgaccccaggaaacaccctcgaggttcgggaatct
ggactgtacagatgccaggcccggggctccccacgaagtaaccctgtgcgcttgctcttt
tcttcagactccttaatcctgcaggcaccatattctgtgtttgaaggtgacacattggtt
ctgagatgccacagaagaaggaaagagaaattgactgctgtgaaatatacttggaatgga
aacattctttccatttctaataaaagctgggatcttcttatcccacaagcaagttcaaat
aacaatggcaattatcgatgcattggatatggagacgagaatgatgtatttagatcaaat
ttcaaaataattaaaattcaagaactatttccacatccagagctgaaagctacagactct
cagcctacagaggggaattctgtaaacctgagctgtgaaacacagcttcctccagagcgg
tcagacaccccacttcacttcaacttcttcagagatggcgaggtcatcctgtcagactgg
agcacgtacccggaactccagctcccaaccgtctggagagaaaactcaggatcctattgg
tgtggtgctgaaacagtgaggggtaacatccacaagcacagtccctcgctacagatccat
gtgcagcggatccctgtgtctggggtgctcctggagacccagccctcagggggccaggct
gttgaaggggagatgctggtccttgtctgctccgtggctgaaggcacaggggataccaca
ttctcctggcaccgagaggacatgcaggagagtctggggaggaaaactcagcgttccctg
agagcagagctggagctccctgccatcagacagagccatgcagggggatactactgtaca
gcagacaacagctacggccctgtccagagcatggtgctgaatgtcactgtgagagagacc
ccaggcaacagagatggccttgtcgccgcgggagccactggagggctgctcagtgctctt
ctcctggctgtggccctgctgtttcactgctggcgtcggaggaagtcaggagttggtttc
ttgggagacgaaaccaggctccctcccgctccaggcccaggagagtcctcccattccatc
tgccctgcccaggtggagcttcagtcgttgtatgttgatgtacaccccaaaaagggagat
ttggtatactctgagatccagactactcagctgggagaagaagaggaagctaatacctcc
aggacacttctagaggataaggatgtctcagttgtctactctgaggtaaagacacaacac
ccagataactcagctggaaagatcagctctaaggatgaagaaagttaa

DBGET integrated database retrieval system