KEGG   Homo sapiens (human): 8342Help
Entry
8342              CDS       T01001                                 

Gene name
H2BC14, H2B/e, H2BFE, HIST1H2BM, dJ160A22.3
Definition
(RefSeq) H2B clustered histone 14
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8342 (H2BC14)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8342 (H2BC14)
  09165 Substance dependence
   05034 Alcoholism
    8342 (H2BC14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8342 (H2BC14)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8342 (H2BC14)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8342 (H2BC14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8342 (H2BC14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 8342
NCBI-ProteinID: NP_003512
OMIM: 602802
HGNC: 4750
Ensembl: ENSG00000273703
Vega: OTTHUMG00000014489
Pharos: Q99879(Tdark)
UniProt: Q99879
Structure
PDB: 

Position
6p22.1
AA seq 126 aa AA seqDB search
MPEPVKSAPVPKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccagtcaaatctgctccagtccctaaaaaaggctccaagaaggccattaac
aaggctcagaagaaggatggaaagaagcgcaaacgcagccgcaaggagagctactctgtg
tatgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcttccaaggctatg
ggaatcatgaactccttcgtcaacgacatctttgagcgtatcgccggagaagcgtcacgc
ctggcgcattacaacaagcgctcgaccatcacttcgagggagatccagacggccgtgcgc
ctactgctacccggggaattggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtataccagctccaagtga

DBGET integrated database retrieval system