KEGG   Homo sapiens (human): 8342
Entry
8342              CDS       T01001                                 

Gene name
H2BC14, H2B/e, H2BFE, HIST1H2BM, dJ160A22.3
Definition
(RefSeq) H2B clustered histone 14
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8342 (H2BC14)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8342 (H2BC14)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8342 (H2BC14)
  09165 Substance dependence
   05034 Alcoholism
    8342 (H2BC14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8342 (H2BC14)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8342 (H2BC14)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8342 (H2BC14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8342 (H2BC14)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Other DBs
NCBI-GeneID: 8342
NCBI-ProteinID: NP_003512
OMIM: 602802
HGNC: 4750
Ensembl: ENSG00000273703
Vega: OTTHUMG00000014489
Pharos: Q99879(Tdark)
UniProt: Q99879
Structure
PDB: 
6MUP 6MUO

Position
6p22.1
AA seq 126 aa
MPEPVKSAPVPKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgaaccagtcaaatctgctccagtccctaaaaaaggctccaagaaggccattaac
aaggctcagaagaaggatggaaagaagcgcaaacgcagccgcaaggagagctactctgtg
tatgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcttccaaggctatg
ggaatcatgaactccttcgtcaacgacatctttgagcgtatcgccggagaagcgtcacgc
ctggcgcattacaacaagcgctcgaccatcacttcgagggagatccagacggccgtgcgc
ctactgctacccggggaattggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtataccagctccaagtga

DBGET integrated database retrieval system