KEGG   Homo sapiens (human): 83439Help
Entry
83439             CDS       T01001                                 

Gene name
TCF7L1, TCF-3, TCF3
Definition
(RefSeq) transcription factor 7 like 1
  KO
K04490  transcription factor 7-like 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05215  Prostate cancer
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05221  Acute myeloid leukemia
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Module
hsa_M00677  Wnt signaling
Network
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00061  CDH1-reduced expression to Wnt signaling pathway
N00175  KSHV LANA to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00257  Loss of CDH1 to Wnt signaling pathway
N00258  Mutation-inactivated CDH1 to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    83439 (TCF7L1)
   04390 Hippo signaling pathway
    83439 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    83439 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    83439 (TCF7L1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    83439 (TCF7L1)
   05210 Colorectal cancer
    83439 (TCF7L1)
   05225 Hepatocellular carcinoma
    83439 (TCF7L1)
   05226 Gastric cancer
    83439 (TCF7L1)
   05216 Thyroid cancer
    83439 (TCF7L1)
   05221 Acute myeloid leukemia
    83439 (TCF7L1)
   05217 Basal cell carcinoma
    83439 (TCF7L1)
   05215 Prostate cancer
    83439 (TCF7L1)
   05213 Endometrial cancer
    83439 (TCF7L1)
   05224 Breast cancer
    83439 (TCF7L1)
  09165 Cardiovascular diseases
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    83439 (TCF7L1)
  09166 Endocrine and metabolic diseases
   04934 Cushing syndrome
    83439 (TCF7L1)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    83439 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    83439 (TCF7L1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    83439 (TCF7L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 83439
NCBI-ProteinID: NP_112573
OMIM: 604652
HGNC: 11640
Ensembl: ENSG00000152284
Vega: OTTHUMG00000130026
Pharos: Q9HCS4(Tbio)
UniProt: Q9HCS4
Position
2p11.2
AA seq 588 aa AA seqDB search
MPQLGGGGGGGGGGSGGGGGSSAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQR
DLDEVKSSLVNESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYP
GYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVP
VVQHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGA
VGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGL
PTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFMLYMKEM
RAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYG
KKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPA
TPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPP
LLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctcggcggcgggggcggcggcggcggcggcggcagcgggggaggcggcggc
tccagcgccggggcggccggcggaggggacgacctcggggcgaacgacgagctgatcccc
ttccaggacgaggggggcgaggagcaggagccgagcagcgatagcgcctcggcgcagcgg
gacctagacgaggtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagctcg
gactcggaggcggagaggcgcccgcagcccgtccgggacactttccagaagccgcgggac
tatttcgccgaagtgagaaggcctcaggacagcgcgttctttaaaggacccccgtaccct
gggtaccccttcctgatgatcccggacctgagcagcccgtacctctccaacggacccctg
tctcccggaggagcgcgcacctacctgcagatgaaatggcccctcctcgatgtcccctcc
agcgccacagtcaaggacacgaggtcaccatctccagcacacttgtctaataaagttcct
gtcgttcagcacccgcatcacatgcatccgctgactcccctcatcacctacagcaatgac
cacttctcccccggctcccctcccacccacctctccccagagatcgatccaaagacagga
atcccccggccccctcacccatccgagctgtcaccgtattacccactctctcccggagct
gtcggacaaatcccccaccccctcggctggctcgtcccacagcaaggccagcccatgtac
tcccttcctcccggtggcttccggcacccttaccccgccctcgccatgaacgcctcgatg
tccagcctggtctccagtcggttctctcctcacatggtggctcctgcccaccctggcctg
cccacctcagggatcccccaccctgccatcgtctcccccatcgtcaagcaggaaccggca
ccccccagcctgagccctgcagtgagcgtgaaatcaccagtcaccgtgaaaaaggaggag
gaaaagaagccccacgtgaagaagcctctgaatgccttcatgttgtatatgaaggagatg
agggccaaggtggtggctgagtgcaccctgaaggaaagtgcagccattaaccagatcctt
ggaagaaagtggcacaacctgtctcgagaagaacaggccaagtactacgagctggcccgg
aaggagcggcagcttcactcgcagctctacccaacctggtcagcccgggacaactatggt
aagaaaaagaagaggaagagagaaaagcagctgtcccagacacagtcacagcagcaagtc
caggaggcagagggtgccctggcctccaagagcaagaagccatgtgttcagtacctgccc
cccgagaagccctgtgacagccctgcctcctcccacgggagcatgctggactccccggcc
actccctctgcagctttggcctcaccagctgcccctgctgccacccattcggagcaagcc
cagcccctctccctcaccaccaaaccagaaacccgggcccagctggctctccactctgcc
gccttcctgtcggctaaggctgcagcctcctcctctgggcagatgggcagccagcctccc
ctcctgtcccggcccctcccccttgggtccatgcccacagctctgctggcctctcccccg
tccttccccgccacgctccatgcccaccaggccctcccggtgctacaggcccagcctctt
tccctggtcaccaagtctgcccactaa

DBGET integrated database retrieval system