KEGG   Homo sapiens (human): 83440Help
Entry
83440             CDS       T01001                                 

Gene name
ADPGK, 2610017G09Rik, ADP-GK
Definition
(RefSeq) ADP dependent glucokinase
  KO
K08074  ADP-dependent glucokinase [EC:2.7.1.147]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    83440 (ADPGK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.147  ADP-specific glucokinase
     83440 (ADPGK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADP_PFK_GK
Motif
Other DBs
NCBI-GeneID: 83440
NCBI-ProteinID: NP_112574
OMIM: 611861
HGNC: 25250
Ensembl: ENSG00000159322
Vega: OTTHUMG00000172777
Pharos: Q9BRR6(Tbio)
UniProt: Q9BRR6
Position
15q24.1
AA seq 496 aa AA seqDB search
MALWRGSAYAGFLALAVGCVFLLEPELPGSALRSLWSSLCLGPAPAPPGPVSPEGRLAAA
WDALIVRPVRRWRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSILHSRNDLEEAFI
HFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLCGP
VGPKLHELLDDNVFVPPESLQEVDEFHLILEYQAGEEWGQLKAPHANRFIFSHDLSNGAM
NMLEVFVSSLEEFQPDLVVLSGLHMMEGQSKELQRKRLLEVVTSISDIPTGIPVHLELAS
MTNRELMSSIVHQVFPAVTSLGLNEQELLFLTQSASGPHSSLSSWNGVPDVGMVSDILFW
ILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETID
TSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGD
AISAEGLFYSEVHPHY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgtggcgcggctccgcgtacgcgggcttcctggcgctggccgtgggctgcgtc
ttcctgctggagccagagctgccaggctcggcgctgcgctctctctggagctcgctgtgt
ctggggcccgcgcctgcgcccccgggacccgtctcccccgagggccggttggcggcagcc
tgggacgcgcttatcgtgcggccagtccggcgctggcgccgcgtggcagtgggagtcaat
gcatgtgttgatgtggtgctctcaggggtgaagctcttgcaggcacttggccttagtcct
gggaatgggaaagatcacagcattctgcattcaaggaatgatctggaagaagccttcatt
cacttcatggggaagggagcagctgctgagcgcttcttcagtgataaggaaacttttcac
gacattgcccaggttgcatcagagttcccaggagcccagcactatgtaggaggaaatgca
gctttaattggacagaaatttgcagccaactcagatttaaaggttcttctttgcggtcca
gttggtccaaagctacatgagcttcttgatgacaatgtctttgttccaccagagtcattg
caggaagtggatgagttccacctcattttagagtatcaagcaggggaggagtggggccag
ttaaaagctccccatgccaaccgattcatcttctctcacgacctctccaacggggccatg
aatatgctggaggtgtttgtgtctagcctggaggagtttcagccagacctggtggtcctc
tctggattgcacatgatggagggacaaagcaaggagctccagaggaagagactcttggag
gttgtaacctccatttctgacatccccactggtattccagttcacctagagctggccagt
atgactaacagggagctcatgagcagcattgtccatcaggtctttcccgcggtgacttcc
cttgggctgaatgaacaggagctgttatttctcacccagtcagcctctggacctcactct
tctctctcttcctggaacggtgttcctgatgtgggcatggtcagtgacatcctcttctgg
atcttgaaagaacatgggaggagtaaaagcagagcctcggatctcaccaggatccatttc
cacacgctggtctaccacatcctggcaactgtggatggacactgggccaaccagctggca
gccgtggctgcaggagctcgtgtggctgggacacaggcctgcgccacagaaaccatagac
accagccgagtgtctctgagggcaccccaagagttcatgacttcccattcggaggcaggc
tccaggattgtattaaacccaaacaagccagtagtagaatggcacagagagggaatatcc
ttccacttcacaccagtattggtgtgtaaagaccccattcgaactgtaggccttggagat
gccatttcagccgaaggactcttctattcggaagtacaccctcactattag

DBGET integrated database retrieval system