KEGG   Homo sapiens (human): 83443
Entry
83443             CDS       T01001                                 
Symbol
SF3B5, SF3b10, Ysf3
Name
(RefSeq) splicing factor 3b subunit 5
  KO
K12832  splicing factor 3B subunit 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    83443 (SF3B5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    83443 (SF3B5)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    83443 (SF3B5)
 Complex B
    83443 (SF3B5)
 Complex C
   U2 SnRNP specific factors
    83443 (SF3B5)
SSDB
Motif
Pfam: SF3b10 DUF2264
Other DBs
NCBI-GeneID: 83443
NCBI-ProteinID: NP_112577
OMIM: 617847
HGNC: 21083
Ensembl: ENSG00000169976
UniProt: Q9BWJ5
Position
6:complement(144094884..144095573)
AA seq 86 aa
MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENES
KARVRFNLMEKMLQPCGPPADKPEEN
NT seq 261 nt   +upstreamnt  +downstreamnt
atgactgaccgctacaccatccatagccagctggagcacctgcagtccaagtacatcggc
acgggccacgccgacaccaccaagtgggagtggctggtgaaccaacaccgcgactcgtac
tgctcctacatgggccacttcgaccttctcaactacttcgccattgcggagaatgagagc
aaagcgcgagtccgcttcaacttgatggaaaagatgcttcagccttgtggaccgccagcc
gacaagcccgaggagaactga

DBGET integrated database retrieval system