KEGG   Homo sapiens (human): 83445
Entry
83445             CDS       T01001                                 

Gene name
GSG1
Definition
(RefSeq) germ cell associated 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: GSG-1 PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 83445
NCBI-ProteinID: NP_001193771
HGNC: 19716
Ensembl: ENSG00000111305
Vega: OTTHUMG00000150148
Pharos: Q2KHT4(Tdark)
UniProt: Q2KHT4 F1T0A1
Position
12p13.1
AA seq 339 aa
MSDPSQLTQNVCLTQEMELSKAFSGQRTLLSAILSMLSLSFSTTSLLSNYWFVGTQKVPK
PLCEKGLAAKCFDMPVSLDGDTNTSTQEVVQYNWETGDDRFSFRSFRSGMWLSCEETVEE
PGERCRSFIELTPPAKREILWLSLGTQITYIGLQFISFLLLLTDLLLTGNPACGLKLSAF
AAVSSVLSGLLGMVAHMMYSQVFQATVNLGPEDWRPHVWNYGWAFYMAWLSFTCCMASAV
TTFNTYTRMVLEFKCKHSKSFKENPNCLPHHHQCFPRRLSSAAPTVGPLTSYHQYHNQPI
HSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVEEEQC
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgagcgatccctctcaactgactcaaaatgtttgcctcacccaggagatggagctctcg
aaggccttctctggccagcggacactcctatctgccatcctcagcatgctatcactcagc
ttctccacaacatccctgctcagcaactactggtttgtgggcacacagaaggtgcccaag
cccctgtgcgagaaaggtctggcagccaagtgctttgacatgccagtgtccctggatgga
gataccaacacatccacccaggaggtggtacaatacaactgggagactggggatgaccgg
ttctccttccggagcttccggagtggcatgtggctatcctgtgaggaaactgtggaagaa
ccaggggagaggtgccgaagtttcattgaacttacaccaccagccaagagagaaatccta
tggttatccctgggaacgcagatcacctacatcggacttcaattcatcagcttcctcctg
ctactaacagacttgctactcactgggaaccctgcctgtgggctcaaactgagcgccttt
gctgctgtttcctctgtcctgtcaggtctcctggggatggtggcccacatgatgtattca
caagtcttccaagcgactgtcaacttgggtccagaagactggagaccacatgtttggaat
tatggctgggccttctacatggcctggctctccttcacctgctgcatggcgtcggctgtc
accaccttcaacacgtacaccaggatggtgctggagttcaagtgcaagcatagtaagagc
ttcaaggaaaacccgaactgcctaccacatcaccatcagtgtttccctcggcggctgtca
agtgcagcccccaccgtgggtcctttgaccagctaccaccagtatcataatcagcccatc
cactctgtctctgagggagtcgacttctactccgagctgcggaacaagggatttcaaaga
ggggccagccaggagctgaaagaagcagttaggtcatctgtagaggaagagcagtgttag

DBGET integrated database retrieval system