KEGG   Homo sapiens (human): 8345
Entry
8345              CDS       T01001                                 

Symbol
H2BC9, H2B/j, H2BFJ, HIST1H2BH
Name
(RefSeq) H2B clustered histone 9
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8345 (H2BC9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8345 (H2BC9)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8345 (H2BC9)
  09165 Substance dependence
   05034 Alcoholism
    8345 (H2BC9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8345 (H2BC9)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8345 (H2BC9)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8345 (H2BC9)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8345 (H2BC9)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Other DBs
NCBI-GeneID: 8345
NCBI-ProteinID: NP_003515
OMIM: 602806
HGNC: 4755
Ensembl: ENSG00000275713
Vega: OTTHUMG00000014447
Pharos: Q93079(Tdark)
UniProt: Q93079
Structure
PDB: 
6MUP 6MUO

Position
6p22.2
AA seq 126 aa
MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgatccagctaagtccgctcccgccccgaagaagggctccaagaaggcggtgacc
aaggcgcagaagaaggatggcaagaagcgtaaacgcagccgcaaggagagctactccgta
tacgtttacaaggtgctgaagcaagtccaccccgacaccggcatctcctccaaagccatg
gggatcatgaattcctttgtcaacgatatcttcgagcgcatcgccggcgaggcttcccgc
ctggctcattacaacaagcgttcgaccatcacctccagggagatccagacagccgtgcgc
ctgctgctgcctggggaactggccaagcacgccgtgtccgagggcactaaggccgtcacc
aagtacaccagctccaaataa

DBGET integrated database retrieval system