KEGG   Homo sapiens (human): 83451Help
Entry
83451             CDS       T01001                                 

Gene name
ABHD11, PP1226, WBSCR21
Definition
(RefSeq) abhydrolase domain containing 11
  KO
K13703  abhydrolase domain-containing protein 11
Organism
hsa  Homo sapiens (human)
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    83451 (ABHD11)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S33
   83451 (ABHD11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 PGAP1 Esterase Thioesterase Lipase_3 PAF-AH_p_II Chlorophyllase Chlorophyllase2 Ndr DUF676 Palm_thioest
Motif
Other DBs
NCBI-GeneID: 83451
NCBI-ProteinID: NP_683710
HGNC: 16407
Ensembl: ENSG00000106077
Vega: OTTHUMG00000130029
Pharos: Q8NFV4(Tdark)
UniProt: Q8NFV4
Position
7q11.23
AA seq 315 aa AA seqDB search
MRAGQQLASMLRWTRAWRLPREGLGPHGPSFARVPVAPSSSSGGRGGAEPRPLPLSYRLL
DGEAALPAVVFLHGLFGSKTNFNSIAKILAQQTGRRVLTVDARNHGDSPHSPDMSYEIMS
QDLQDLLPQLGLVPCVVVGHSMGGKTAMLLALQRPELVERLIAVDISPVESTGVSHFATY
VAAMRAINIADELPRSRARKLADEQLSSVIQDMAVRQHLLTNLVEVDGRFVWRVNLDALT
QHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIMRLFPRAQMQTVPNAGHWIHA
DRPQDFIAAIRGFLV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccggccaacagcttgcaagcatgctccgctggacccgagcctggaggctcccg
cgtgagggactcggcccccacggccctagcttcgcgagggtgcctgtcgcacccagcagc
agcagcggcggccgagggggcgccgagccgaggccgcttccgctttcctacaggcttctg
gacggggaggcagccctcccggccgtcgtctttttgcacgggctcttcggcagcaaaact
aacttcaactccatcgccaagatcttggcccagcagacaggccgtagggtgctgacggtg
gatgctcgtaaccacggtgacagcccccacagcccagacatgagctacgagatcatgagc
caggacctgcaggaccttctgccccagctgggcctggtgccctgcgtcgtcgttggccac
agcatgggaggaaagacagccatgctgctggcactacagaggccagagctggtggaacgt
ctcattgctgtagatatcagcccagtggaaagcacaggtgtctcccactttgcaacctat
gtggcagccatgagggccatcaacatcgcagatgagctgccccgctcccgtgcccgaaaa
ctggcggatgaacagctcagttctgtcatccaggacatggccgtgcggcagcacctgctc
actaacctggtagaggtagacgggcgcttcgtgtggagggtgaacttggatgccctgacc
cagcacctagacaagatcttggctttcccacagaggcaggagtcctacctcgggccaaca
ctctttctccttggtggaaactcccagttcgtgcatcccagccaccaccctgagattatg
cggctcttccctcgggcccagatgcagacggtgccgaacgctggccactggatccacgct
gaccgcccacaggacttcatagctgccatccgaggcttcctggtctaa

DBGET integrated database retrieval system