KEGG   Homo sapiens (human): 8346Help
Entry
8346              CDS       T01001                                 

Gene name
H2BC10, H2B/k, H2BC4, H2BC6, H2BC7, H2BC8, H2BFK, HIST1H2BI
Definition
(RefSeq) H2B clustered histone 10
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8346 (H2BC10)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8346 (H2BC10)
  09165 Substance dependence
   05034 Alcoholism
    8346 (H2BC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8346 (H2BC10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8346 (H2BC10)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8346 (H2BC10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8346 (H2BC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 8346
NCBI-ProteinID: NP_003516
OMIM: 602807
HGNC: 4756
Ensembl: ENSG00000278588
Vega: OTTHUMG00000014448
UniProt: P62807 B2R4S9
Structure
PDB: 

Position
6p22.2
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccagctaagtcagctcccgccccgaagaagggctccaagaaggcggtgacc
aaggcacagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagctattccgtg
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggctatg
gggattatgaactccttcgtcaacgacattttcgagcgcattgcaggcgaggcttcccgc
ctggcgcattataacaagcgctcgaccatcacttccagggagatccaaacggctgtgcgc
ctgctgctacccggggagctggccaaacacgcggtgtcggagggcaccaaggcggtcacc
aagtacaccagctccaagtaa

DBGET integrated database retrieval system