KEGG   Homo sapiens (human): 83464
Entry
83464             CDS       T01001                                 
Symbol
APH1B, APH-1B, PRO1328, PSFL, TAAV688, aph-1beta
Name
(RefSeq) aph-1 homolog B, gamma-secretase subunit
  KO
K06172  gamma-secretase subunit APH-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa05010  Alzheimer disease
Network
nt06511  NOTCH signaling
  Element
N01478  Notch proteolytic activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    83464 (APH1B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    83464 (APH1B)
SSDB
Motif
Pfam: Aph-1
Other DBs
NCBI-GeneID: 83464
NCBI-ProteinID: NP_112591
OMIM: 607630
HGNC: 24080
Ensembl: ENSG00000138613
UniProt: Q8WW43
Position
15:63277605..63309126
AA seq 257 aa
MTAAVFFGCAFIAFGPALALYVFTIATEPLRIIFLIAGAFFWLVSLLISSLVWFMARVII
DNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPGETAPSMRLLAYVS
GLGFGIMSGVFSFVNTLSDSLGPGTVGIHGDSPQFFLYSAFMTLVIILLHVFWGIVFFDG
CEKKKWGILLIVLLTHLLVSAQTFISSYYGINLASAFIILVLMGTWAFLAAGGSCRSLKL
CLLCQDKNFLLYNQRSR
NT seq 774 nt   +upstreamnt  +downstreamnt
atgactgcggccgtgttcttcggctgcgccttcattgccttcgggcctgcgctcgccctt
tatgtcttcaccatcgccaccgagccgttgcgtatcatcttcctcatcgccggagctttc
ttctggttggtgtctctactgatttcgtcccttgtttggttcatggcaagagtcattatt
gacaacaaagatggaccaacacagaaatatctgctgatctttggagcgtttgtctctgtc
tatatccaagaaatgttccgatttgcatattataaactcttaaaaaaagccagtgaaggt
ttgaagagtataaacccaggtgagacagcaccctctatgcgactgctggcctatgtttct
ggcttgggctttggaatcatgagtggagtattttcctttgtgaataccctatctgactcc
ttggggccaggcacagtgggcattcatggagattctcctcaattcttcctttattcagct
ttcatgacgctggtcattatcttgctgcatgtattctggggcattgtattttttgatggc
tgtgagaagaaaaagtggggcatcctccttatcgttctcctgacccacctgctggtgtca
gcccagaccttcataagttcttattatggaataaacctggcgtcagcatttataatcctg
gtgctcatgggcacctgggcattcttagctgcgggaggcagctgccgaagcctgaaactc
tgcctgctctgccaagacaagaactttcttctttacaaccagcgctccagataa

DBGET integrated database retrieval system