KEGG   Homo sapiens (human): 83468
Entry
83468             CDS       T01001                                 

Gene name
GLT8D2
Definition
(RefSeq) glycosyltransferase 8 domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Glyco_transf_8 Glyco_transf_24
Other DBs
NCBI-GeneID: 83468
NCBI-ProteinID: NP_001303896
HGNC: 24890
Ensembl: ENSG00000120820
Vega: OTTHUMG00000170120
Pharos: Q9H1C3(Tdark)
UniProt: Q9H1C3
Position
12q23.3
AA seq 349 aa
MALLRKINQVLLFLLIVTLCVILYKKVHKGTVPKNDADDESETPEELEEEIPVVICAAAG
RMGATMAAINSIYSNTDANILFYVVGLRNTLTRIRKWIEHSKLREINFKIVEFNPMVLKG
KIRPDSSRPELLQPLNFVRFYLPLLIHQHEKVIYLDDDVIVQGDIQELYDTTLALGHAAA
FSDDCDLPSAQDINRLVGLQNTYMGYLDYRKKAIKDLGISPSTCSFNPGVIVANMTEWKH
QRITKQLEKWMQKNVEENLYSSSLGGGVATSPMLIVFHGKYSTINPLWHIRHLGWNPDAR
YSEHFLQEAKLLHWNGRHKPWDFPSVHNDLWESWFVPDPAGIFKLNHHS
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggctctgttacgaaaaattaatcaggtgctgctgttccttctgatcgtgaccctctgt
gtgattctgtataagaaagttcataaggggactgtgcccaagaatgacgcagatgatgaa
tccgagactcctgaagaactggaagaagagattcctgtggtgatttgtgctgcagcaggg
aggatgggtgccactatggctgccatcaatagcatctacagcaacactgacgccaacatc
ttgttctatgtagtgggactccggaatactctgactcgaatacgaaaatggattgaacat
tccaaactgagagaaataaactttaaaatcgtggaattcaacccgatggtcctcaaaggg
aagatcagaccagactcatcgaggcctgaattgctccagcctctgaactttgttcgattt
tatctccctctacttatccaccaacacgagaaagtcatctatttggacgatgatgtaatt
gtacaaggtgatatccaagaactgtatgacaccaccttggccctgggccacgcggcggct
ttctcagatgactgcgatttgccctctgctcaggacataaacagactcgtgggacttcag
aacacatatatgggctatctggactaccggaagaaggccatcaaggaccttggcatcagc
cccagcacctgctctttcaatcctggtgtgattgttgccaacatgacagaatggaagcac
cagcgcatcaccaagcaattggagaaatggatgcaaaagaatgtggaggaaaacctctat
agcagctccctgggaggaggggtggccacctccccaatgctgattgtgtttcatgggaaa
tattccacaattaaccccctgtggcacataaggcacctgggctggaatccagatgccaga
tattcggagcattttctgcaggaagctaaattactccactggaatggaagacataaacct
tgggacttccctagtgttcacaacgacttatgggaaagctggtttgttcctgaccctgca
gggatatttaaactcaatcaccatagctga

DBGET integrated database retrieval system