KEGG   Homo sapiens (human): 83473
Entry
83473             CDS       T01001                                 
Symbol
KATNAL2
Name
(RefSeq) katanin catalytic subunit A1 like 2
  KO
K07767  katanin p60 ATPase-containing subunit A1 [EC:5.6.1.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    83473 (KATNAL2)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.1  microtubule-severing ATPase
     83473 (KATNAL2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Katanin
     83473 (KATNAL2)
SSDB
Motif
Pfam: AAA AAA_lid_3 RuvB_N AAA_16 TIP49 AAA_5 AAA_33 AAA_22 AAA_24 AAA_7 Mg_chelatase RNA_helicase IstB_IS21 AAA_14 AAA_25 AAA_18 DUF815 TsaE AAA_28 NACHT bpMoxR Parvo_NS1 PhoH
Other DBs
NCBI-GeneID: 83473
NCBI-ProteinID: NP_112593
OMIM: 614697
HGNC: 25387
Ensembl: ENSG00000167216
Pharos: Q8IYT4(Tdark)
UniProt: Q8IYT4
Position
18:46917594..47102243
AA seq 466 aa
MEYESYYFVKFQKYPKIVKKSSDTAENNLPQRSRGKTRRMMNDSCQNLPKINQQRPRSKT
TAGKTGDTKSLNKEHPNQEVVDNTRLESANFGLHISRIRKDSGEENAHPRRGQIIDFQGL
LTDAIKGATSELALNTFDHNPDPSERLLKPLSAFIGMNSEMRELAAVVSRDIYLHNPNIK
WNDIIGLDAAKQLVKEAVVYPIRYPQLFTGILSPWKGLLLYGPPGTGKTLLAKAVATECK
TTFFNISASTIVSKWRGDSEKLVRVLFELARYHAPSTIFLDELESVMSQRGTASGGEHEG
SLRMKTELLVQMDGLARSEDLVFVLAASNLPWELDCAMLRRLEKRILVDLPSREARQAMI
YHWLPPVSKSRALELHTELEYSVLSQETEGYSGSDIKLVCREAAMRPVRKIFDALENHQS
ESSDLPRIQLDIVTTADFLDVLTHTKPSAKNLAQRYSDWQREFESV
NT seq 1401 nt   +upstreamnt  +downstreamnt
atggaatatgagagttattattttgtaaaatttcagaaataccccaaaattgtcaaaaag
tcatcagacacagcagaaaataatttaccgcaaagaagtagagggaagaccagaaggatg
atgaacgacagttgtcaaaatcttcccaagatcaatcagcagaggccccggtccaaaacc
acagcggggaagacaggggacaccaaatcgctcaataaggagcatcctaatcaggaggta
gttgataacactcgcctggaaagtgccaacttcggcctacatatatcaagaatccgtaaa
gacagtggagaggaaaatgcccacccacgaagaggccaaatcattgacttccaagggctg
ctcacagatgccatcaagggagcaaccagtgaacttgccttgaacaccttcgaccataat
ccagacccctcagaacgactgctgaaacctctgagtgcatttattggcatgaacagtgag
atgcgagaattggcagccgtggtgagccgggacatttatctccataatccaaacataaag
tggaatgacattattggacttgatgcagccaagcagttagtcaaagaagctgttgtgtat
cctataaggtatccacagctatttacaggaattctttctccctggaaaggactactgctg
tacggccctccaggtacaggaaagactttactggccaaagctgtggccactgaatgtaaa
acaaccttctttaacatttctgcatccaccattgtcagcaaatggagaggggattcagaa
aaactcgttcgggtgttatttgagcttgcccgctaccacgccccatccacgatcttcctg
gacgagctggagtcggtgatgagtcagagaggcacagcttctgggggagaacatgaagga
agcctgcggatgaagacagagttactggtgcagatggatgggctggcacgctcagaagat
ctcgtatttgtcttagcagcttctaacctgccgtgggagctggactgtgccatgttacgc
cgcctggagaagaggattctggtcgatctccccagccgggaggccaggcaggccatgatc
taccactggctgcctcctgtgagcaagagcagggccttggagctgcacacagagctggag
tacagtgtgctgagccaggagactgagggctactcaggctcagatattaagctcgtctgc
agggaagcagccatgcggcccgtgaggaagatctttgatgcacttgaaaatcaccagtca
gaaagcagcgacttacccaggatccagttggatatagtaaccactgccgactttctggat
gtgctaactcacaccaagccctccgcaaagaatctggctcagagatactcagactggcaa
agagagttcgagtctgtctga

DBGET integrated database retrieval system