KEGG   Homo sapiens (human): 83478Help
Entry
83478             CDS       T01001                                 

Gene name
ARHGAP24, FILGAP, RC-GAP72, RCGAP72, p73, p73RhoGAP
Definition
(RefSeq) Rho GTPase activating protein 24
  KO
K20642  Rho GTPase-activating protein 22/24/25
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    83478 (ARHGAP24)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    83478 (ARHGAP24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP PH PH_11 ATG16 FPP DUF3435 bZIP_1 Mod_r
Motif
Other DBs
NCBI-GeneID: 83478
NCBI-ProteinID: NP_001020787
OMIM: 610586
HGNC: 25361
Ensembl: ENSG00000138639
Vega: OTTHUMG00000130427
Pharos: Q8N264(Tbio)
UniProt: Q8N264
Position
4q21.23-q21.3
AA seq 748 aa AA seqDB search
MEENNDSTENPQQGQGRQNAIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPL
GTIFLPGNKVSEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSI
RRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQA
NLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSK
EEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPK
VEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQKKATMGQLQN
KENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMV
KKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNG
TVRMGILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFS
MMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDD
LSHPRDYESKSDHRSVGGRSSRATSSSDNSETFVGNSSSNHSALHSLVSSLKQEMTKQKI
EYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQK
EMEQFFSTFGELTVEPRRTERGNTIWIQ
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaacaatgactccacggagaacccccaacaaggccaagggcggcagaatgcc
atcaagtgtgggtggctgaggaagcaaggaggctttgtcaagacttggcatactcgctgg
tttgtgctcaagggggatcagctctattatttcaaagatgaagatgaaaccaagcccttg
ggtactatttttctgcctggaaataaagtttctgagcatccctgcaatgaagagaaccca
gggaagttcctttttgaagtagttccaggaggcgatcgagatcggatgacagcaaatcat
gaaagctacctcctcatggcaagcacccagaatgatatggaagactgggtgaagtcaatc
cgccgagtcatatggggacctttcggaggaggcatttttggacagaaactggaggatact
gttcgttatgagaagagatatgggaaccgtctggctccgatgttggtggagcagtgcgtg
gactttatccgacaaagggggctgaaagaagagggtctctttcgactgccaggccaggct
aatcttgttaaggagctccaagatgcctttgactgtggggagaagccatcatttgacagc
aacacagatgtacacacggtggcatcacttcttaagctgtacctccgagaacttccagaa
ccagttattccttatgcgaagtatgaagattttttgtcatgtgccaaactgctcagcaag
gaagaggaagcaggtgttaaggaattagcaaagcaggtgaagagtttgccagtggtaaat
tacaacctcctcaagtatatttgcagattcttggatgaagtacagtcctactcgggagtt
aacaaaatgagtgtgcagaacttggcaacggtctttggtcctaatatcctgcgccccaaa
gtggaagatcctttgactatcatggagggcactgtggtggtccagcagttgatgtcagtg
atgattagcaaacatgattgcctctttcccaaagatgcagaactacaaagcaagccccaa
gatggagtgagcaacaacaatgaaattcagaagaaagccaccatggggcagttacagaac
aaggagaacaataacaccaaggacagccctagtaggcagtgctcctgggacaagtctgag
tcaccccagagaagcagcatgaacaatggatcccccacagctctatcaggcagcaaaacc
aacagcccaaagaacagtgttcacaagctagatgtgtctagaagcccccctctcatggtc
aaaaagaacccagcctttaataagggtagtgggatagttaccaatgggtccttcagcagc
agtaatgcagaaggtcttgagaaaacccaaaccacccccaatgggagcctacaggccaga
aggagctcttcactgaaggtatctggtaccaaaatgggcacgcacagtgtacagaatgga
acggtgcgcatgggcattttgaacagcgacacactcgggaaccccacaaatgttcgaaac
atgagctggctgccaaatggctatgtgaccctgagggataacaagcagaaagaacaagct
ggagagttaggccagcacaacagactgtccacctatgataatgtccatcaacagttctcc
atgatgaaccttgatgacaagcagagcattgacagtgctacctggtccacttcctcctgt
gaaatctccctccctgagaactccaactcctgtcgctcttctaccaccacctgcccagag
caagacttttttggggggaactttgaggaccctgttttggatgggcccccgcaggacgac
ctttcccaccccagggactatgaaagcaaaagtgaccacaggagtgtgggaggtcgaagt
agtcgtgccaccagtagcagtgacaacagtgagacatttgtgggcaacagcagcagcaac
cacagtgcactgcacagtttagtttccagcctgaaacaggaaatgaccaaacagaagata
gagtatgagtccaggataaagagcttagaacagcgaaacttgactttggaaacagaaatg
atgagcctccatgatgaactggatcaggagaggaaaaagttcacaatgatagaaataaaa
atgcgaaatgccgagcgagcaaaagaagatgccgagaaaagaaatgacatgctacagaaa
gaaatggagcagtttttttccacgtttggagaactgacagtggaacccaggagaaccgag
agaggaaacacaatatggattcagtga

DBGET integrated database retrieval system