KEGG   Homo sapiens (human): 8348Help
Entry
8348              CDS       T01001                                 

Gene name
HIST1H2BO, H2B.2, H2B/n, H2BFN, dJ193B12.2
Definition
(RefSeq) histone cluster 1 H2B family member o
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    8348 (HIST1H2BO)
  Immune diseases
   05322 Systemic lupus erythematosus
    8348 (HIST1H2BO)
  Substance dependence
   05034 Alcoholism
    8348 (HIST1H2BO)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    8348 (HIST1H2BO)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8348 (HIST1H2BO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 8348
NCBI-ProteinID: NP_003518
OMIM: 602808
HGNC: 4758
Ensembl: ENSG00000274641
Vega: OTTHUMG00000014493
Pharos: P23527(Tdark)
UniProt: P23527
Position
6p22.1
AA seq 126 aa AA seqDB search
MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacccggctaaatctgctcctgcccccaaaaagggctccaagaaagccgtaacc
aaggcccagaaaaaggacggcaagaagcgcaagcgcagccgcaaagagagttactctatc
tacgtgtacaaggtgctgaagcaagtccaccccgacaccggcatctcatcgaaggccatg
ggcatcatgaactccttcgtcaatgacatctttgagcgcatcgctggcgaggcttcccgc
ctggcgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcacaaaggccgtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system