KEGG   Homo sapiens (human): 83481Help
Entry
83481             CDS       T01001                                 

Gene name
EPPK1, EPIPL, EPIPL1
Definition
(RefSeq) epiplakin 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Plectin
Motif
Other DBs
NCBI-GeneID: 83481
NCBI-ProteinID: NP_112598
OMIM: 607553
HGNC: 15577
Ensembl: ENSG00000261150
Vega: OTTHUMG00000165206
Pharos: P58107(Tdark)
UniProt: P58107
Position
8q24.3
AA seq 5088 aa AA seqDB search
MSGHTLPPLPVPGTNSTEQASVPRAMAATLGAGTPPRPQARSIAGVYVEASGQAQSVYAA
MEQGLLPAGLGQALLEAQAATGGLVDLARGQLLPVSKALQQGLVGLELKEKLLAAERATT
GYPDPYGGEKLALFQAIGKEVVDRALGQSWLEVQLATGGLVDPAQGVLVAPEPACHQGLL
DRETWHKLSELEPGTGDLRFLDPNTLERLTYHQLLERCVRAPGSGLALLPLKITFRSMGG
AVSAAELLEVGILDEQAVQGLREGRLAAVDVSARAEVRRYLEGTGSVAGVVLLPEGHKKS
FFQAATEHLLPMGTALPLLEAQAATHTLVDPITGQRLWVDEAVRAGLVSPELHEQLLVAE
QAVTGHHDPFSGSQIPLFQAMKKGLVDRPLALRLLDAQLATGGLVCPARRLRLPLEAALR
CGCLDEDTQRQLSQAGSFSDGTHGGLRYEQLLALCVTDPETGLAFLPLSGGPRGGEPQGP
PFIKYSTRQALSTATATVSVGKFRGRPVSLWELLFSEAISSEQRAMLAQQYQEGTLSVEK
LAAKLSATLEQAAATARVTFSGLRDTVTPGELLKAEIIDQDLYERLEHGQATAKDVGSLA
SVQRYLQGTGCIAGLLLPGSQERLSIYEARCKGLLRPGTALILLEAQAATGFIIDPKANK
GHSVEEALRAAVIGPDVFAKLLSAERAVTGYTDPYTGQQISLFQAMQKGLIVREHGIRLL
EAQIATGGVIDPVHSHRVPVDVAYRRGYFDQMLNLILLDPSDDTKGFFDPNTHENLTYLQ
LLERCVRDPETGLYLLPLSSTQSPLVDSATQQAFQNLLLSVKYGRFQGQRVSAWELINSE
YFSEGRRRQLLRRYRQREVTLGQVAKLLEAETQRQADIMLPALRSRVTVHQLLEAGIIDQ
QLLDQVLAGTISPEALLLMDGVRRYLCGLGAVGGVRLLPSGQRLSLYQAMRQKLLGPRVA
LALLEAQAATGTIMDPHSPESLSVDEAVRRGVVGPELYGRLKRAEGAIAGFRDPFSGKQV
SVFQAMKKGLIPWEQAARLLEAQVATGGIIDPTSHHHLPMPVAIQRGYVDQEMETALSSS
SETFPTPDGQGRTSYAQLLEECPRDETSGLHLLPLPESAPALPTEEQVQRSLQAVPGAKD
GTSLWDLLSSCHFTEEQRRGLLEDVQEGRTTVPQLLASVQRWVQETKLLAQARVMVPGPR
GEVPAVWLLDAGIITQETLEALAQGTQSPAQVAEQPAVKACLWGTGCVAGVLLQPSGAKA
SIAQAVRDGLLPTGLGQRLLEAQVASGFLVDPLNNQRLSVEDAVKVGLVGRELSEQLGQA
ERAAAGYPDPYSRASLSLWQAMEKGLVPQNEGLPLLQVQLATGGVVDPVHGVHLPQAAAC
RLGLLDTQTSQVLTAVDKDNKFFFDPSARDQVTYQQLRERCVCDSETGLLLLPLPSDTVL
EVDDHTAVALRAMKVPVSTGRFKGCSVSLWDLLLSEYVGADKRRELVALCRSGRAAALRQ
VVSAVTTLVEAAERQPLQATFRGLRKQVSARDLFRAQLISRKTLDELSQGTTTVKEVAEM
DSVKRSLEGGNFIAGVLIQGTQERMSIPEALRRHILRPGTALVLLEAQAATGFIIDPVEN
RKLTVEEAFKAGMFGKETYVKLLSAERAVTGYTDPYTGQQISLFQAMQKDLIVREHGIRL
LEAQIATGGIIDPVHSHRVPVDVAYRCGYFDEEMNRILADPSDDTKGFFDPNTHENLTYL
QLLERCVEDPETGLYLLQIIKKGENYVYINEATRHVLQSRTAKMRVGRFADQVVSFWDLL
SSPYFTEDRKRELIQEYGAQSGGLEKLLEIITTTIEETETQNQGIKVAAIRGEVTAADLF
NSRVIDQKTLHTLRVGRTGGQALSTLECVKPYLEGSGCIAGVTVPSTREVMSLHEASRKE
LIPAAFATWLLEAQAATGFLLDPCTRQKLSVDEAVDVGLVNEELRERLLKAERAATGYRD
PATGDTIPLFQAMQKQLIEKAEALRLLEVQVATGGVIDPQHHHRLPLETAYRRGCLHKDI
YALISDQKHMRKRFVDPNTQEKVSYRELQERCRPQEDTGWLLFPVNKAARDSEHIDDETR
RALEAEQVEITVGRFRGQKPTLWALLNSEYVTEEKKLQLVRMYRTHTRRALQTVAQLILE
LIEKQETSNKHLWFQGIRRQITASELLSSAIITEEMLQDLETGRSTTQELMEDDRVKRYL
EGTSCIAGVLVPAKDQPGRQEKMSIYQAMWKGVLRPGTALVLLEAQAATGFVIDPVRNLR
LSVEEAVAAGVVGGEIQEKLLSAERAVTGYTDPYTGQQISLFQAMQKDLIVREHGIRLLE
AQIATGGVIDPVHSHRVPVDVAYRRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYVQL
LRRCVPDPDTGLYMLQLAGRGSAVHQLSEELRCALRDARVTPGSGALQGQSVSVWELLFY
REVSEDRRQDLLSRYRAGTLTVEELGATLTSLLAQAQAQARAEAEAGSPRPDPREALRAA
TMEVKVGRLRGRAVPVWDVLASGYVSRAAREELLAEFGSGTLDLPALTRRLTAIIEEAEE
APGARPQLQDAWRGPREPGPAGRGDGDSGRSQREGQGEGETQEAAAAAAAAAARRQEQTL
RDATMEVQRGQFQGRPVSVWDVLFSSYLSEARRDELLAQHAAGALGLPDLVAVLTRVIEE
TEERLSKVSFRGLRRQVSASELHTSGILGPETLRDLAQGTKTLQEVTEMDSVKRYLEGTS
CIAGVLVPAKDQPGRQEKMSIYQAMWKGVLRPGTALVLLEAQAATGFVIDPVRNLRLSVE
EAVAAGVVGGEIQEKLLSAERAVTGYTDPYTGQQISLFQAMQKDLIVREHGIRLLEAQIA
TGGVIDPVHSHRVPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYVQLLRRC
VPDPDTGLYMLQLAGRGSAVHQLSEELRCALRDARVTPGSGALQGQSVSVWELLFYREVS
EDRRQDLLSRYRAGTLTVEELGATLTSLLAQAQAQARAEAEAGSPRPDPREALRAATMEV
KVGRLRGRAVPVWDVLASGYVSRAAREELLAEFGSGTLDLPALTRRLTAIIEEAEEAPGA
RPQLQDAWRGPREPGPAGRGDGDSGRSQREGQGEGETQEAAAAARRQEQTLRDATMEVQR
GQFQGRPVSVWDVLFSSYLSEARRDELLAQHAAGALGLPDLVAVLTRVIEETEERLSKVS
FRGLRCQVSASELHTSGILGPETLRDLAQGTKTLQEVTEMDSVKRYLEGTSCIAGVLVPA
KDQPGRQEKMSIYQAMWKGVLRPGTALVLLEAQAATGFVIDPVRNLRLSVEEAVAAGVVG
GEIQEKLLSAERAVTGYTDPYTGQQISLFQAMQKDLIVREHGIRLLEAQIATGGVIDPVH
SHRVPVDVAYRRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYVQLLRRCVPDPDTGLY
MLQLAGRGSAVHQLSEELRCALRDARVTPGSGALQGQSVSVWELLFYREVSEDRRQDLLS
RYRAGTLTVEELGATLTSLLAQAQAQARAEAEAGSPRPDPREALRAATMEVKVGRLRGRA
VPVWDVLASGYVSRAAREELLAEFGSGTLDLPALTRRLTAIIEEAEEAPGARPQLQDAWR
GPREPGPAGRGDGDSGRSQREGQGEGETQEAAAATAAARRQEQTLRDATMEVQRGQFQGR
PVSVWDVLFSSYLSEARRDELLAQHAAGALGLPDLVAVLTRVIEETEERLSKVSFRGLRR
QVSASELHTSGILGPETLRDLAQGTKTLQEVTEMDSVKRYLEGTSCIAGVLVPAKDQPGR
QEKMSIYQAMWKGVLRPGTALVLLEAQAATGFVIDPVRNLRLSVEEAVAAGVVGGEIQEK
LLSAERAVTGYTDPYTGQQISLFQAMQKDLIVREHGIRLLEAQIATGGVIDPVHSHRVPV
DVAYRRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYVQLLRRCVPDPDTGLYMLQLAG
RGSAVHQLSEELRCALRDARVTPGSGALQGQSVSVWELLFYREVSEDRRQDLLSRYRAGT
LTVEELGATLTSLLAQAQAQARAEAEAGSPRPDPREALRAATMEVKVGRLRGRAVPVWDV
LASGYVSRAAREELLAEFGSGTLDLPALTRRLTAIIEEAEEAPGARPQLQDAWRGPREPG
PAGRGDGDSGRSQREGQGEGETQEAAAATAAARRQEQTLRDATMEVQRGQFQGRPVSVWD
VLFSSYLSEARRDELLAQHAAGALGLPDLVAVLTRVIEETEERLSKVSFRGLRRQVSASE
LHTSGILGPETLRDLAQGTKTLQEVTEMDSVKRYLEGTSCIAGVLVPAKDQPGHQEKMSI
YQAMWKGVLRPGTALVLLEAQAATGFVIDPVRNLRLSVEEAVAAGVVGGEIQEKLLSAER
AVTGYTDPYTGQQISLFQAMQKDLIVREHGIRLLEAQIATGGVIDPVHSHRVPVDVAYRR
GYFDEEMNRVLAHPSDDTKGFFDPNTHENLTYVQLLRRCVPDPDTGLYMLQLAGRGSAVH
QLSEELRCALRDARVMPGSGALQGQSVSVWELLFYREVSEDRRQDLLSRYRAGTLTVEEL
GATLTSLLAQAQAQARAEAEAEAGSPRPDPREALRAATMEVKVGRLRGRAVPVWDVLASG
YVSGAAREELLAEFGSGTLDLPALTRRLTAIIEEAEEAPGARPQLQDAWRGPREPGPAGR
GDGDSGRSQREGQGEGETQEAAAAARRQEQTLRDATMEVQRGQFQGRPVSVWDVLFSSYL
SEAHRDELLAQHAAGALGLPDLVAVLTRVIEETEERLSKVSFRGLRRQVSASELHTSGIL
GPETLRDLAQGTKTLQEVTEMDSVKRYLEGTSCIAGVLVPAKDQPGRQEKMSIYQAMWKG
VLRPGTALVLLEAQAATGFVIDPVRNLRLSVEEAVAAGVVGGEIQEKLLSAERAVTGYTD
PYTGQQISLFQAMQKDLIVREHGIRLLEAQIATGGVIDPVHSHRVPVDVAYRRGYFDEEM
NRVLADPSDDTKGFFDPNTHENLTYLQLLQRATLDPETGLLFLSLSLQ
NT seq 15267 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccacaccttgcctcctcttcccgtcccaggcaccaacagcacagagcaggcc
agtgtacccagagccatggcagccacgctgggagccggcacgccccccaggccccaggcc
aggagcatagctggggtgtatgtggaggcctcgggccaggcccagagtgtctacgccgcc
atggagcagggcctcctgcctgctgggctcgggcaggctctgctagaggcccaggcagcc
actgggggcctggtggacctcgcccggggccagctgctccctgtgtccaaggccctgcag
cagggtctggtggggctggagctgaaggagaagctgctggccgctgagcgtgccactacg
ggctatcctgacccctacggcggtgagaagctggccctctttcaggccatcgggaaggag
gttgtggacagggccctggggcagagctggctggaggtccaactggccactgggggcctg
gtggaccccgcccagggagtgctcgtggcccctgagccagcctgccaccagggcctcctg
gaccgggagacatggcacaagctgtcagagcttgagcctggcacaggtgacctgcgcttc
ctcgaccccaacacgctggagcggctgacataccaccagctgctggaaaggtgtgtgcgt
gcccccggctcggggctagccttgctgcccctcaagatcaccttccgctccatgggcggg
gcggtgagtgcagctgagctgctggaggtgggcatcctggacgagcaggctgtgcagggt
ctgcgggagggcaggctggccgcagtggacgtgagtgcacgtgccgaggtgcggcgctac
ctggagggtaccggcagcgtggccggggttgtcctgctgcccgaaggccacaagaagagc
tttttccaggctgccaccgagcacctgctcccaatgggcaccgcgctgccactcctagag
gcccaggctgccacccacaccctggtggaccccatcacaggccagcggctgtgggtagac
gaggcagtcagggcgggcctggtcagcccagagctccatgagcagctcctggtggccgag
caggccgtgacagggcaccacgaccccttcagtggctcccaaatcccccttttccaggcc
atgaagaaggggctagtggacaggccactggcactgcggctcttggatgcccagctggcc
acaggcgggctggtctgtccagcacgcaggctccggctgcccctggaggccgccctgcgc
tgcggctgcctggatgaagacactcagcggcagctctcgcaggctggcagcttctcagac
ggcacgcacggcggcctgcgctatgaacagctgctggccctctgtgtcaccgacccagag
accgggcttgccttcctgccactctcagggggaccccggggaggggagccccagggaccc
ccattcatcaagtacagcactcggcaggccctgagcacggccacagccaccgtctctgtg
gggaagttccggggccggcccgtgtccctctgggagctgctcttctctgaggccatctcc
tcagagcagagggcgatgctggcccagcagtaccaggaagggaccctctccgtggagaag
ctggccgctaagctgagcgccaccctcgagcaggctgcagccactgccagggtcaccttt
tctgggctgagggacaccgtgacaccaggagagctgctgaaagccgagatcatcgaccag
gacctgtacgagcggctggagcatggacaggccacagccaaggatgtgggcagcctggcc
tcggtgcagaggtacctgcagggtacgggctgcattgctggcctgctgctccctggctcc
caggaacgcctgagcatctatgaggcccgatgcaaggggctcctccggcccggcactgcc
ctcatccttctggaggcacaagctgccacaggcttcatcatcgacccaaaagcaaacaag
gggcactccgttgaggaggcactgagggctgctgtcattgggcctgatgtgttcgcgaag
ctgctgtcggctgagcgcgctgtcactggctacactgacccctacaccgggcagcagatc
tccctcttccaggccatgcagaagggcctcatcgtccgggagcacggcatccgcctgctg
gaggcccagatcgccacgggcggcgtcatcgaccccgtgcacagccaccgcgtgcccgtg
gacgtggcctaccggcgcggctacttcgatcagatgctgaacttgatcctgttggaccct
tctgacgacaccaagggcttcttcgaccccaacacgcacgagaacctcacgtacctgcag
cttctggagcgctgtgtgcgtgaccccgagacgggcctgtacctcctgccactcagcagc
acgcagtccccgctggtggacagtgccacccagcaggccttccagaacctgctgctctcc
gtgaagtatggacggtttcaggggcagagggtctccgcgtgggagctgatcaactctgag
tacttcagcgagggccgcaggaggcagctgctgcgtcgctaccggcagcgcgaggtcacg
ctggggcaggtggcaaagctgctggaggcggagacgcagagacaggcggacatcatgctg
cccgcactgcggagccgggtcaccgtccaccagctcctggaggccggtatcattgaccag
cagctgttggaccaagtgctggccgggacaatcagcccggaggccctcctactcatggac
ggcgtccgcaggtacctgtgcggcctgggagctgtgggcggtgtgcggctgctgccctct
ggccagcggctcagcctctaccaggccatgaggcagaagctgctggggcccagggtggcc
ctggccctgctggaggcccaggcggccaccggaaccatcatggaccctcacagcccagag
agcctctcggtggatgaggccgtgcgcaggggtgtggtggggccggagctgtatggcagg
ctgaagcgggctgagggtgccattgctggcttcagagaccccttctctgggaagcaggtg
tctgtgttccaggccatgaagaaaggtctcatcccttgggagcaagctgcccgcctcctg
gaggctcaagtggccacaggagggatcattgaccccaccagccaccaccacctccccatg
ccagtggccattcagcgtggctatgttgaccaggagatggagacagccttgtccagctcc
tccgaaaccttccccacaccggacggccaggggcgcacgagctatgcccagctcctggag
gagtgccccagggatgagacttctggccttcacctcctgcccctgccagaaagtgctcct
gccctccccaccgaggagcaggtccagaggagcctgcaggccgtgccgggggccaaggat
ggcacatccctctgggacctgctcagctcctgccacttcaccgaggagcaacggaggggc
ctgctggaggacgtgcaggaggggaggaccactgtgccacagctgctagcctctgtgcag
aggtgggtacaggagaccaagctcctggcccaggcccgcgtcatggtgcccggcccacgg
ggtgaggtacccgctgtctggctgctggatgctggcatcatcacccaggagacccttgag
gccctggctcagggcacgcagtcgcccgcccaggtcgccgagcagccggcggtgaaggcc
tgcctgtggggcacaggctgcgtggccggtgtgctgctacagccctctggggccaaggcc
agcatcgcccaggccgtgagggatggcctcctgcccacaggcctgggccagaggctgctg
gaagcccaggtggcatctggcttccttgttgaccccctgaacaaccagagactgtcagtg
gaggacgcggttaaggtcggcctggtgggcagggagctgagtgagcagctcgggcaggcc
gagagggcggcggccgggtacccagatccctactctagggcctccctctctctgtggcag
gccatggagaaggggctcgtgccacagaacgagggcttgcccctcctgcaggtgcagctg
gccacagggggtgtggtggaccctgtccacggggtgcacctgccccaggcggcagcctgc
agactcggccttctggacacacagacgagccaggtgctgactgcagttgacaaggacaac
aagttcttctttgaccccagtgcgcgggaccaggtgacctaccagcagctcagggagcgc
tgcgtgtgcgactccgagaccggattgttgctgttgccactgccctcagacacagtgctt
gaggtggacgaccacaccgcggtggctctgagggccatgaaggtgcccgtcagcacaggg
aggtttaaggggtgtagcgtgtcactctgggacctgctgctctccgaatacgttggcgct
gacaagcggcgggagctggtggcactctgtcggtctgggagggctgcggccctgcggcag
gtggtcagcgcagtcaccaccctggtcgaggctgcagagaggcagcccctgcaggccacc
ttcagagggctccggaagcaggtgtcagccagggacctgttcagggcgcagctgatcagc
aggaagacgctggacgagctgagccaggggacaacgactgtgaaggaggtggcggagatg
gacagcgtgaagcggtccctggagggaggcaacttcattgccggggtccttatccagggc
acccaggagaggatgagcatcccagaggccctgaggaggcacatcctgcggcctggcaca
gccctggtgctgctggaggcacaggcagctaccggcttcatcatcgaccccgtggagaac
cggaagctgaccgtggaggaggcgttcaaagcaggaatgttcgggaaagaaacctacgtg
aagctgctgtcggccgagcgcgccgtcaccggctacaccgacccctataccgggcagcag
atctccctcttccaggccatgcagaaggacctcatcgtccgggagcacggcatccgcctg
ctggaggcccagatcgccacgggcggcatcatcgaccccgtgcacagccaccgcgtgccc
gtggacgtggcctaccgctgcggctacttcgacgaggagatgaaccgcatcctggcggac
cccagcgacgacaccaagggcttcttcgaccccaacacgcacgagaacctcacgtacctg
cagcttctggagcgctgtgtggaggaccccgagacgggcctgtacctgctacaaatcata
aagaaaggagaaaactacgtgtacatcaatgaggccacgagacacgtgttgcaatccaga
actgcaaaaatgcgcgtggggaggtttgctgaccaggtggtctctttctgggacctgctg
tcctctccatacttcacagaggacaggaagcgggagctcatccaggagtatggagcccag
agtgggggcctggagaaattgctggaaatcatcaccacgacaattgaagaaacagagacg
caaaaccaaggcatcaaagtggcggccatcagaggggaggtgacagctgcagacctgttc
aactccagggtcatcgatcagaagaccctgcacacacttcgtgtggggaggactggggga
caggcactcagcacgctggagtgtgtgaagccctatctggaaggcagcggctgcattgcg
ggggtcacggtgccctccaccagggaggtcatgagcctccatgaggccagcaggaaggag
ctcatccctgcagcatttgcgacttggctgctggaggcgcaggccgccaccgggttcctc
ctggacccctgcacccgccagaagctctctgtggatgaggctgtggatgtgggcctggtg
aacgaggagctgcgggagaggctcctgaaggctgaaagagctgccacgggctacagggat
ccggccacaggagacacgatcccgctgttccaggccatgcagaagcagctcatcgagaag
gcggaggcactgaggctgctggaggtgcaggtggccacggggggtgtcatcgacccacag
caccaccaccggctcccactggaaacagcctacagacggggctgtctgcacaaggacatc
tatgcgctcatttccgaccagaagcacatgaggaaacggtttgtggacccgaacacgcaa
gagaaggtctcgtaccgagagctgcaggagaggtgccgcccacaagaggacacgggctgg
ctgctgttcccagtgaacaaggctgcacgggactccgagcacatcgatgacgagacgaga
agggccctggaggcagagcaagtggaaatcacagtgggaaggttcagaggccagaaacca
acactgtgggcactactgaattccgaatacgtgacagaggagaagaagctccagctggtg
aggatgtatagaacacacaccagacgggcactgcagacggtagcgcagctcatcttagag
ttgatcgagaagcaggaaaccagcaacaaacacctgtggttccaaggaattagacgacag
atcacagcttctgaactcctcagctcagccataatcacggaggaaatgctccaggacctg
gaaacgggacggagcacgacgcaagagctcatggaggacgaccgcgtcaagcgctacctg
gagggcaccagctgcatcgcgggcgtcctggtgcccgccaaggaccagcccggccgccag
gagaagatgagcatctaccaggccatgtggaagggcgtgctgcggcccggcacggccctg
gtgctgctggaggcgcaggcggccaccggcttcgtcatcgaccccgtgcgcaacctgagg
ctgtcggtggaggaggccgtggccgcgggcgtggtgggcggcgagatccaggagaagctg
ctgtcggccgagcgcgccgtcaccggctacaccgacccctacaccgggcagcagatctcc
ctcttccaggccatgcagaaggacctcatcgtccgggagcacggcatccgcctgctggag
gcccagatcgccacgggcggcgtcatcgaccccgtgcacagccaccgcgtgcccgtggac
gtggcctaccggcgcggctacttcgacgaggagatgaaccgtgtcctggccgaccccagc
gacgacaccaagggcttcttcgaccccaacacgcacgagaacctcacgtacgtgcagctg
ctgcgccgctgcgtgcccgacccggacaccgggctctacatgctgcagctggcaggccgg
ggctccgccgtgcaccagctgagcgaggagctgcgctgtgccctgcgcgacgcccgcgtg
acgccaggctcgggcgccctccagggccagagcgtctccgtctgggagctcctcttctac
cgcgaggtgtccgaggaccggcgccaggacctgctgagcagataccgggcgggcacgctg
accgtggaggagctgggcgccaccctcacctcgctgctggcccaggcccaggcccaggcc
cgggccgaggccgaggccgggagcccgcgcccagacccccgggaggccctgcgtgcggcc
accatggaggtcaaggtgggccgcctccgggggcgcgcggtgcccgtgtgggacgtgctg
gcgtccggctacgtgagcagggccgcccgggaggagctgctggccgagtttggctcgggg
accctggacttgcccgcgctgacccgccggctgaccgccatcatcgaggaggccgaggag
gcccccggggcccggccgcagctccaggacgcctggcgcggcccgcgggagccagggcca
gccgggcgaggggacggcgactcggggcgctcccagcgagagggccagggggagggcgag
acccaggaggccgccgccgccgccgccgccgccgccgcccgccgccaggagcagaccctg
cgtgatgccaccatggaggtgcagcgcgggcagttccaggggcggccggtctccgtgtgg
gacgtcctcttctcctcgtacctgagcgaggcccgccgagacgagctcctggcccagcac
gcggccggcgccctgggcctgcccgacctcgtcgccgtcctcacccgggtcatcgaggag
accgaggagcggctcagcaaggtgtccttccgcggcctgaggcgccaggtgtccgcctcc
gagctgcacacgtccgggatcctgggccccgagaccctgcgggacctggcccagggcact
aagacgctgcaggaggtgacggagatggactcggtcaagcgctacctggagggcaccagc
tgcatcgcgggcgtcctggtgcccgccaaggaccagcccggccgccaggagaagatgagc
atctaccaggccatgtggaagggcgtgctgcggcccggcacggccctggtgctgctggag
gcgcaggcggccaccggcttcgtcatcgaccccgtgcgcaacctgaggctgtcggtggag
gaggccgtggccgcgggcgtggtgggcggcgagatccaggagaagctgctgtcggccgag
cgcgccgtcaccggctacaccgacccctacaccgggcagcagatctccctcttccaggcc
atgcagaaggacctcatcgtccgggagcacggcatccgcctgctggaggcccagatcgcc
acgggcggcgtcatcgaccccgtgcacagccaccgcgtgcccgtggacgtggcctaccag
cgcggctacttcgacgaggagatgaaccgtgtcctggccgaccccagcgacgacaccaag
ggcttcttcgaccccaacacgcacgagaacctcacgtacgtgcagctgctgcgccgctgc
gtgcccgacccggacaccgggctctacatgctgcagctggcaggccggggctccgccgtg
caccagctgagcgaggagctgcgctgtgccctgcgcgacgcccgcgtgacgccaggctcg
ggcgccctccagggccagagcgtctccgtctgggagctcctcttctaccgcgaggtgtcc
gaggaccggcgccaggacctgctgagcagataccgggcgggcacgctgaccgtggaagag
ctgggcgccaccctcacctcgctgctggcccaggcccaggcccaggcccgggccgaggcc
gaggccgggagcccgcgcccagacccccgggaggccctgcgtgcggccaccatggaggtc
aaggtgggccgcctccgggggcgcgcggtgcccgtgtgggacgtgctggcgtccggctac
gtgagcagggccgcccgggaggagctgctggccgagtttggctcggggaccctggacttg
cccgcgctgacccgccggctgaccgccatcatcgaggaggccgaggaggcccccggggcc
cggccgcagctccaggacgcctggcgcggcccgcgggagccagggccagccgggcgaggg
gacggcgactcggggcgctcccagcgagagggccagggggagggcgagacccaggaggcc
gccgccgccgcccgccgccaggagcagaccctgcgtgatgccaccatggaggtgcagcgc
gggcagttccaggggcggccggtctccgtgtgggacgtcctcttctcctcgtacctgagc
gaggcccgccgagacgagctcctggcccagcacgcggccggcgccctgggcctgcccgac
ctcgtcgccgtcctcacccgggtcatcgaggagacggaggagcggctcagcaaggtgtcc
ttccgcggcctgaggtgccaggtgtccgcctccgagctgcacacgtccgggatcctgggc
cccgagaccctgcgggacctggcccagggcactaagacgctgcaggaggtgacggagatg
gactcggtcaagcgctacctggagggcaccagctgcatcgcgggcgtcctggtgcccgcc
aaggaccagcccggccgccaggagaagatgagcatctaccaggccatgtggaagggcgtg
ctgcggcccggcacggccctggtgctgctggaggcgcaggcggccaccggcttcgtcatc
gaccccgtgcgcaacctgaggctgtcggtggaggaggccgtggccgcgggcgtggtgggc
ggcgagatccaggagaagctgctgtcggccgagcgcgccgtcaccggctacaccgacccc
tacaccgggcagcagatctccctcttccaggccatgcagaaggacctcatcgtccgggag
cacggcatccgcctgctggaggcccagatcgccacgggcggcgtcatcgaccccgtgcac
agccaccgcgtgcccgtggacgtggcctaccggcgcggctacttcgacgaggagatgaac
cgtgtcctggccgaccccagcgacgacaccaagggcttcttcgaccccaacacgcacgag
aacctcacgtacgtgcagctgctgcgccgctgcgtgcccgacccggacaccgggctctac
atgctgcagctggcaggccggggctccgccgtgcaccagctgagcgaggagctgcgctgt
gccctgcgcgacgcccgcgtgacgccaggctcgggcgccctccagggccagagcgtctcc
gtctgggagctcctcttctaccgcgaggtgtccgaggaccggcgccaggacctgctgagc
agataccgggcgggcacgctgaccgtggaggagctgggcgccaccctcacctcgctgctg
gcccaggcccaggcccaggcccgggccgaggccgaggccgggagcccgcgcccagacccc
cgggaggccctgcgtgcggccaccatggaggtcaaggtgggccgcctccgggggcgcgcg
gtgcccgtgtgggacgtgctggcgtccggctacgtgagcagggccgcccgggaggagctg
ctggccgagtttggctcggggaccctggacttgcccgcgctgacccgccggctgaccgcc
atcatcgaggaggccgaggaggcccccggggcccggccgcagctccaggacgcctggcgc
ggcccgcgggagccagggccagccgggcgaggggacggcgactcggggcgctcccagcga
gagggccagggggagggcgagacccaggaggccgccgccgccaccgccgccgcccgccgc
caggagcagaccctgcgtgatgccaccatggaggtgcagcgcgggcagttccaggggcgg
ccggtctccgtgtgggacgtcctcttctcctcgtacctgagcgaggcccgccgagacgag
ctcctggcccagcacgcggccggcgccctgggcctgcccgacctcgtcgccgtcctcacc
cgggtcatcgaggagacggaggagcggctcagcaaggtgtccttccgcggcctgaggcgc
caggtgtccgcctccgagctgcacacgtccgggatcctgggccccgagaccctgcgggac
ctggcccagggcactaagacgctgcaggaggtgacggagatggactcggtcaagcgctac
ctggagggcaccagctgcatcgcgggcgtcctggtgcccgccaaggaccagcccggccgc
caggagaagatgagcatctaccaggccatgtggaagggcgtgctgcggcccggcacggcc
ctggtgctgctggaggcgcaggcggccaccggcttcgtcatcgaccccgtgcgcaacctg
aggctgtcggtggaggaggccgtggccgcgggcgtggtgggcggcgagatccaggagaag
ctgctgtcggccgagcgcgccgtcaccggctacaccgacccctacaccgggcagcagatc
tccctcttccaggccatgcagaaggacctcatcgtccgggagcacggcatccgcctgctg
gaggcccagatcgccacgggcggcgtcatcgaccccgtgcacagccaccgcgtgcccgtg
gacgtggcctaccggcgcggctacttcgacgaggagatgaaccgtgtcctggccgacccc
agcgacgacaccaagggcttcttcgaccccaacacgcacgagaacctcacgtacgtgcag
ctgctgcgccgctgcgtgcccgacccggacaccgggctctacatgctgcagctggcaggc
cggggctccgccgtgcaccagctgagcgaggagctgcgctgtgccctgcgcgacgcccgc
gtgacgccaggctcgggcgccctccagggccagagcgtctccgtctgggagctcctcttc
taccgcgaggtgtccgaggaccggcgccaggacctgctgagcagataccgggcgggcacg
ctgaccgtggaggagctgggcgccaccctcacctcgctgctggcccaggcccaggcccag
gcccgggccgaggccgaggccgggagcccgcgcccagacccccgggaggccctgcgtgcg
gccaccatggaggtcaaggtgggccgcctccgggggcgcgcggtgcccgtgtgggacgtg
ctggcgtccggctacgtgagcagggccgcccgggaggagctgctggccgagtttggctcg
gggaccctggacttgcccgcgctgacccgccggctgaccgccatcatcgaggaggccgag
gaggcccccggggcccggccgcagctccaggacgcctggcgcggcccgcgggagccaggg
ccagccgggcgaggggacggcgactcggggcgctcccagcgagagggccagggggagggc
gagacccaggaggccgccgccgccaccgccgccgcccgccgccaggagcagaccctgcgt
gatgccaccatggaggtgcagcgcgggcagttccaggggcggccggtctccgtgtgggac
gtcctcttctcctcgtacctgagcgaggcccgccgagacgagctcctggcccagcacgcg
gccggcgccctgggcctgcccgacctcgtcgccgtcctcacccgggtcatcgaggagacg
gaggagcggctcagcaaggtgtccttccgcggcctgaggcgccaggtgtccgcctccgag
ctgcacacgtccgggatcctgggccccgagaccctgcgggacctggcccagggcactaag
acgctgcaggaggtgacggagatggactcggtcaagcgctacctggagggcaccagctgc
atcgcgggcgtcctggtgcccgccaaggaccagcccggccaccaggagaagatgagcatc
taccaggccatgtggaagggcgtgctgcggcccggcacggccctggtgctgctggaggcg
caggcggccaccggcttcgtcatcgaccccgtgcgcaacctgaggctgtcggtggaggag
gccgtggccgcgggcgtggtgggcggcgagatccaggagaagctgctgtcggccgagcgc
gccgtcaccggctacaccgacccctacaccgggcagcagatctccctcttccaggccatg
cagaaggacctcatcgtccgggagcacggcatccgcctgctggaggcccagatcgccacg
ggcggcgtcatcgaccccgtgcacagccaccgcgtgcccgtggacgtggcctaccggcgc
ggctacttcgacgaggagatgaaccgtgtcctggcccaccccagcgacgacaccaagggc
ttcttcgaccccaacacgcacgagaacctcacgtacgtgcagctgctgcgccgctgcgtg
cccgacccggacaccgggctctacatgctgcagctggcaggccggggctccgccgtgcac
cagctgagcgaggagctgcgctgtgccctgcgcgacgcccgcgtgatgccaggctcgggc
gccctccagggccagagcgtctccgtctgggagctcctcttctaccgcgaggtgtccgag
gaccggcgccaggacctgctgagcagataccgggcgggcacgctgaccgtggaggagctg
ggcgccaccctcacctcgctgctggcccaggcccaggcccaggcccgggccgaggccgag
gccgaggccgggagcccgcgcccagacccccgggaggccctgcgtgcggccaccatggag
gtcaaggtgggccgcctccgggggcgcgcggtgcccgtgtgggacgtgctggcgtccggc
tacgtgagcggggccgcccgggaggagctgctggccgagtttggctcggggaccctggac
ttgcccgcgctgacccgccggctgaccgccatcatcgaggaggccgaggaggcccccggg
gcccggccgcagctccaggacgcctggcgcggcccgcgggagccagggccagccgggcga
ggggacggcgactcggggcgctcccagcgagagggccagggggagggcgagacccaggag
gccgccgccgccgcccgccgccaggagcagaccctgcgtgatgccaccatggaggtgcag
cgcgggcagttccaggggcggccggtctccgtgtgggacgtcctcttctcctcgtacctg
agcgaggcccaccgagacgagctcctggcccagcacgcggccggcgccctgggcctgccc
gacctcgtcgccgtcctcacccgggtcatcgaggagacggaggagcggctcagcaaggtg
tccttccgcggcctgaggcgccaggtgtccgcctccgagctgcacacgtccgggatcctg
ggccccgagaccctgcgggacctggcccagggcactaagacgctgcaggaggtgacggag
atggactcggtcaagcgctacctggagggcaccagctgcatcgcgggcgtcctggtgccc
gccaaggaccagcccggccgccaggagaagatgagcatctaccaggccatgtggaagggc
gtgctgcggcccggcacggccctggtgctgctggaggcgcaggcggccaccggcttcgtc
atcgaccccgtgcgcaacctgaggctgtcggtggaggaggccgtggccgcgggcgtggtg
ggcggcgagatccaggagaagctgctgtcggccgagcgcgccgtcaccggctacaccgac
ccctacaccgggcagcagatctccctcttccaggccatgcagaaggacctcatcgtccgg
gagcacggcatccgcctgctggaggcccagatcgccacgggcggcgtcatcgaccccgtg
cacagccaccgcgtgcccgtggacgtggcctaccggcgcggctacttcgacgaggagatg
aaccgcgtcctggccgaccccagcgacgacaccaagggcttcttcgaccccaacacgcac
gagaacctcacgtacctgcagcttctgcagagggccaccctggaccctgagacggggctc
ctatttctttctctctctctacagtga

DBGET integrated database retrieval system