KEGG   Homo sapiens (human): 8349
Entry
8349              CDS       T01001                                 

Gene name
H2BC21, GL105, H2B, H2B.1, H2BE, H2BFQ, H2BGL105, H2BQ, HIST2H2BE
Definition
(RefSeq) H2B clustered histone 21
  KO
K11252  histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8349 (H2BC21)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8349 (H2BC21)
  09165 Substance dependence
   05034 Alcoholism
    8349 (H2BC21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8349 (H2BC21)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8349 (H2BC21)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8349 (H2BC21)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8349 (H2BC21)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Other DBs
NCBI-GeneID: 8349
NCBI-ProteinID: NP_003519
OMIM: 601831
HGNC: 4760
Ensembl: ENSG00000184678
Vega: OTTHUMG00000012095
Pharos: Q16778(Tbio)
UniProt: Q16778
Structure
PDB: 
6A7U

Position
1q21.2
AA seq 126 aa
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcctgaaccggcaaaatccgctccggcccctaaaaagggctccaagaaagccgtcacc
aaagcccagaagaaagacggcaagaagcgcaagcgcagccgcaaagagagctactccatc
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg
ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggagaggcttcccgc
ctggcgcactacaacaagcgctccaccatcacatcccgcgagatccagacggccgtgcgc
ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system