KEGG   Homo sapiens (human): 8350
Entry
8350              CDS       T01001                                 

Gene name
H3C1, H3/A, H3C10, H3C11, H3C12, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, HIST1H3A
Definition
(RefSeq) H3 clustered histone 1
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8350 (H3C1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8350 (H3C1)
  09165 Substance dependence
   05034 Alcoholism
    8350 (H3C1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    8350 (H3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8350 (H3C1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8350 (H3C1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8350 (H3C1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8350 (H3C1)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 8350
NCBI-ProteinID: NP_003520
OMIM: 602810
HGNC: 4766
Ensembl: ENSG00000275714
Vega: OTTHUMG00000014418
UniProt: P68431
Structure
PDB: 

Position
6p22.2
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgcactaagcaaactgctcggaagtctactggtggcaaggcgccacgcaaacag
ttggccactaaggcagcccgcaaaagcgctccggccaccggcggcgtgaaaaagccccac
cgctaccggccgggcaccgtggctctgcgcgagatccgccgttatcagaagtccactgaa
ctgcttattcgtaaactacctttccagcgcctggtgcgcgagattgcgcaggactttaaa
acagacctgcgtttccagagctccgctgtgatggctctgcaggaggcgtgcgaggcctac
ttggtagggctatttgaggacactaacctgtgcgccatccacgccaagcgcgtcactatc
atgcccaaggacatccagctcgcccgccgcatccgcggagagagggcgtga

DBGET integrated database retrieval system