KEGG   Homo sapiens (human): 8350
Entry
8350              CDS       T01001                                 

Gene name
H3C1, H3/A, H3C10, H3C11, H3C12, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, HIST1H3A
Definition
(RefSeq) H3 clustered histone 1
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8350 (H3C1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8350 (H3C1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    8350 (H3C1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8350 (H3C1)
  09165 Substance dependence
   05034 Alcoholism
    8350 (H3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8350 (H3C1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8350 (H3C1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8350 (H3C1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8350 (H3C1)
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 8350
NCBI-ProteinID: NP_003520
OMIM: 602810
HGNC: 4766
Ensembl: ENSG00000275714
Vega: OTTHUMG00000014418
UniProt: P68431
Structure
PDB: 

Position
6p22.2
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgcactaagcaaactgctcggaagtctactggtggcaaggcgccacgcaaacag
ttggccactaaggcagcccgcaaaagcgctccggccaccggcggcgtgaaaaagccccac
cgctaccggccgggcaccgtggctctgcgcgagatccgccgttatcagaagtccactgaa
ctgcttattcgtaaactacctttccagcgcctggtgcgcgagattgcgcaggactttaaa
acagacctgcgtttccagagctccgctgtgatggctctgcaggaggcgtgcgaggcctac
ttggtagggctatttgaggacactaacctgtgcgccatccacgccaagcgcgtcactatc
atgcccaaggacatccagctcgcccgccgcatccgcggagagagggcgtga

DBGET integrated database retrieval system