KEGG   Homo sapiens (human): 8352Help
Entry
8352              CDS       T01001                                 

Gene name
HIST1H3C, H3.1, H3/c, H3FC
Definition
(RefSeq) histone cluster 1 H3 family member c
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    8352 (HIST1H3C)
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    8352 (HIST1H3C)
  09165 Substance dependence
   05034 Alcoholism
    8352 (HIST1H3C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8352 (HIST1H3C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8352 (HIST1H3C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    8352 (HIST1H3C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8352 (HIST1H3C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 8352
NCBI-ProteinID: NP_003522
OMIM: 602812
HGNC: 4768
Ensembl: ENSG00000278272
Vega: OTTHUMG00000014416
UniProt: P68431
Structure
PDB: 

Position
6p22.2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtacgaagcaaacagctcgcaagtctaccggcggcaaagctccgcgcaagcag
cttgctactaaagcagcccgtaagagcgctccggccaccggtggcgtgaagaaacctcat
cgctaccgcccgggcaccgtggccttgcgcgaaatccgtcgctaccagaagtccaccgag
ctgctgatccggaagctgccgttccagcgcctggtgcgagaaatcgcccaggacttcaaa
accgacctgcgtttccagagctctgcggtgatggcgctgcaggaggcttgtgaggcctac
ctggtgggactcttcgaagacaccaatctgtgcgctattcacgctaaacgcgtcaccatc
atgcccaaagatatccagctggcacgtcgcatccgtggggaaagggcataa

DBGET integrated database retrieval system