KEGG   Homo sapiens (human): 8352
Entry
8352              CDS       T01001                                 
Symbol
H3C3, H3.1, H3/c, H3C1, H3C10, H3C11, H3C12, H3C2, H3C4, H3C6, H3C7, H3C8, H3FC, HIST1H3C
Name
(RefSeq) H3 clustered histone 3
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8352 (H3C3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8352 (H3C3)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    8352 (H3C3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8352 (H3C3)
  09165 Substance dependence
   05034 Alcoholism
    8352 (H3C3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8352 (H3C3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8352 (H3C3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8352 (H3C3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8352 (H3C3)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 8352
NCBI-ProteinID: NP_003522
OMIM: 602812
HGNC: 4768
Ensembl: ENSG00000287080
UniProt: P68431
Structure
Position
6:26045384..26045869
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacgaagcaaacagctcgcaagtctaccggcggcaaagctccgcgcaagcag
cttgctactaaagcagcccgtaagagcgctccggccaccggtggcgtgaagaaacctcat
cgctaccgcccgggcaccgtggccttgcgcgaaatccgtcgctaccagaagtccaccgag
ctgctgatccggaagctgccgttccagcgcctggtgcgagaaatcgcccaggacttcaaa
accgacctgcgtttccagagctctgcggtgatggcgctgcaggaggcttgtgaggcctac
ctggtgggactcttcgaagacaccaatctgtgcgctattcacgctaaacgcgtcaccatc
atgcccaaagatatccagctggcacgtcgcatccgtggggaaagggcataa

DBGET integrated database retrieval system