KEGG   Homo sapiens (human): 8359Help
Entry
8359              CDS       T01001                                 

Gene name
HIST1H4A, H4FA
Definition
(RefSeq) histone cluster 1 H4 family member a
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    8359 (HIST1H4A)
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    8359 (HIST1H4A)
  09165 Substance dependence
   05034 Alcoholism
    8359 (HIST1H4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8359 (HIST1H4A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    8359 (HIST1H4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Motif
Other DBs
NCBI-GeneID: 8359
NCBI-ProteinID: NP_003529
OMIM: 602822
HGNC: 4781
Ensembl: ENSG00000278637
Vega: OTTHUMG00000014419
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
6p22.2
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacgtggtaagggcgggaagggtttgggtaaggggggtgccaagcgccaccgc
aaggtgttgcgtgacaacatccagggcatcaccaagccggccatccggcgtctggcccgg
cgtggcggtgtgaagcggatctctggtctgatctacgaggagactcgcggggtgctcaag
gtgtttttggagaacgtgatccgtgacgctgtcacctatacggagcacgccaagcgcaag
acagtcactgccatggacgtggtctacgcgcttaagcgccagggacgcaccctttatggc
tttggcggttaa

DBGET integrated database retrieval system