KEGG   Homo sapiens (human): 83592
Entry
83592             CDS       T01001                                 

Gene name
AKR1E2, AKR1CL2, AKRDC1, LoopADR, TAKR, hTSP, htAKR
Definition
(RefSeq) aldo-keto reductase family 1 member E2
  KO
K13981  1,5-anhydro-D-fructose reductase [EC:1.1.1.263]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    83592 (AKR1E2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.263  1,5-anhydro-D-fructose reductase
     83592 (AKR1E2)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 83592
NCBI-ProteinID: NP_001035267
OMIM: 617451
HGNC: 23437
Ensembl: ENSG00000165568
Vega: OTTHUMG00000017577
Pharos: Q96JD6(Tbio)
UniProt: Q96JD6
Position
10p15.1
AA seq 320 aa
MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVR
REDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSE
LSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERL
LNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKR
IAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNL
RLAMFPITKNHKDYPFHIEY
NT seq 963 nt   +upstreamnt  +downstreamnt
atgggagatatcccagccgtgggcctcagctcctggaaggcttctccagggaaagtgacc
gaggcagtgaaagaggccattgacgcagggtaccggcacttcgactgtgcttacttttac
cacaatgagagggaggttggagcagggatccgttgcaagatcaaggaaggcgctgtaaga
cgggaggatctgttcattgccactaagctgtggtgcacctgccataagaagtccttggtg
gaaacagcatgcagaaagagtctcaaggccttgaagctgaactatttggacctctacctc
atacactggcccatgggtttcaagcctcctcatccagaatggatcatgagctgcagtgaa
ctttccttctgcctctcacatcctcgagtgcaggacttgcctctggacgagagcaacatg
gttattcccagtgacacggacttcctggacacgtgggaggccatggaggacctggtgatc
accgggctggtgaagaacatcggggtgtcaaacttcaaccatgaacagcttgagaggctt
ttgaataagcctgggttgaggttcaagccactaaccaaccagattgagtgccacccatat
cttactcagaagaatctgatcagtttttgccaatccagagatgtgtccgtgactgcttac
cgtcctcttggtggctcgtgtgagggggttgacctgatagacaaccctgtgatcaagagg
attgcaaaggagcacggcaagtctcctgctcagattttgatccgatttcaaatccagagg
aatgtgatagtgatccccggatctatcaccccaagtcacattaaagagaatatccaggtg
tttgattttgaattaacacagcacgatatggataacatcctcagcctaaacaggaatctc
cgactggccatgttccccataactaaaaatcacaaagactatcctttccacatagaatac
tga

DBGET integrated database retrieval system