KEGG   Homo sapiens (human): 83593Help
Entry
83593             CDS       T01001                                 

Gene name
RASSF5, Maxp1, NORE1, NORE1A, NORE1B, RAPL, RASSF3
Definition
(RefSeq) Ras association domain family member 5
  KO
K08015  Ras association domain-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04218  Cellular senescence
hsa04670  Leukocyte transendothelial migration
hsa05200  Pathways in cancer
hsa05223  Non-small cell lung cancer
Network
nt06213  Other RAS signaling
nt06266  Non-small cell lung cancer
  Element
N00096  EGF-EGFR-RAS-RASSF1 signaling pathway
N00097  Loss of RASSF1 to RAS-RASSF1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    83593 (RASSF5)
   04015 Rap1 signaling pathway
    83593 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    83593 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    83593 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    83593 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    83593 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Motif
Other DBs
NCBI-GeneID: 83593
NCBI-ProteinID: NP_872604
OMIM: 607020
HGNC: 17609
Ensembl: ENSG00000266094
Vega: OTTHUMG00000184616
Pharos: Q8WWW0(Tbio)
UniProt: Q8WWW0 A8K5F3
Structure
PDB: 

Position
1q32.1
AA seq 418 aa AA seqDB search
MAMASPAIGQRPYPLLLDPEPPRYLQSLSGPELPPPPPDRSSRLCVPAPLSTAPGAREGR
SARRAARGNLEPPPRASRPARPLRPGLQQRLRRRPGAPRPRDVRSIFEQPQDPRVPAERG
EGHCFAELVLPGGPGWCDLCGREVLRQALRCTNCKFTCHPECRSLIQLDCSQQEGLSRDR
PSPESTLTVTFSQNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFI
KVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSE
VIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLK
ENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRESQGKPG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcgtccccggccatcgggcagcgcccgtacccgctactattggaccccgag
ccgccgcgctatctacagagcctgagcggccccgagctaccgccgccgccccccgaccgg
tcctcgcgcctctgtgtcccggcgcccctctccactgcgcccggggcgcgcgaggggcgc
agcgcccggagggctgcccgggggaacctggagcccccgccccgggcctcccgacccgct
cgcccgctccggcctggtctgcagcagagactgcggcggcggcctggagcgccccgaccc
cgcgacgtgcggagcatcttcgagcagccgcaggatcccagagtcccggcggagcgaggc
gaggggcactgcttcgccgagttggtgctgccgggcggccccggctggtgtgacctgtgc
ggacgagaggtgctgcggcaggcgctgcgctgcactaactgtaaattcacctgtcaccca
gaatgccgcagcctgatccagttggactgcagtcagcaggagggtttatcccgggacaga
ccctctccagaaagcaccctcaccgtgaccttcagccagaatgtctgtaaacctgtggag
gagacacagcgcccgcccacactgcaggagatcaagcagaagatcgacagctacaacacg
cgagagaagaactgcctgggcatgaaactgagtgaagacggcacctacacgggtttcatc
aaagtgcatctgaaactccggcggcctgtgacggtgcctgctgggatccggccccagtcc
atctatgatgccatcaaggaggtgaacctggcggctaccacggacaagcggacatccttc
tacctgcccctagatgccatcaagcagctgcacatcagcagcaccaccaccgtcagtgag
gtcatccaggggctgctcaagaagttcatggttgtggacaatccccagaagtttgcactt
tttaagcggatacacaaggacggacaagtgctcttccagaaactctccattgctgaccgc
cccctctacctgcgcctgcttgctgggcctgacacggaggtcctcagctttgtgctaaag
gagaatgaaactggagaggtagagtgggatgccttctccatccctgaacttcagaacttc
ctaacaatcctggaaaaagaggagcaggacaaaatccaacaagtgcaaaagaagtatgac
aagtttaggcagaaactggaggaggccttaagagaatcccagggcaaacctgggtaa

DBGET integrated database retrieval system