KEGG   Homo sapiens (human): 83596
Entry
83596             CDS       T01001                                 

Gene name
BCL2L12
Definition
(RefSeq) BCL2 like 12
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CF222
Other DBs
NCBI-GeneID: 83596
NCBI-ProteinID: NP_619580
OMIM: 610837
HGNC: 13787
Ensembl: ENSG00000126453
Vega: OTTHUMG00000183239
Pharos: Q9HB09(Tbio)
UniProt: Q9HB09
Position
19q13.33
AA seq 334 aa
MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKF
VRVQWRRPQVEWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPR
SPAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQ
RLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVR
LSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGL
SVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgggacggcccgctgggctgttcccgcccctatgcccttttttgggtttccggccagag
gcatgctgggagcgtcacatgcaaattgagcgtgcacccagcgttccgccctttctacgc
tgggccggttatcgacccggcccagtgcgcaggcgcgggaaagttgaactaataaagttt
gtacgagttcagtggaggagaccgcaagttgagtggaggaggcggcggtggggccccgga
ccaggtgcctccatggcaggctctgaagagctggggctccgggaagacacgctgagggtc
ctagctgccttccttaggcgtggtgaggctgccgggtctcctgttccaactccacctaga
agccctgcccaagaagagccaacagacttcctgagccgccttcgaagatgtcttccctgc
tccctggggcgaggagcagccccctctgagtcccctcggccttgctctctgcccatccgc
ccctgctatggtttagagcctggcccagctactccagacttctatgctttggtggcccag
cggctggaacagctggtccaagagcagctgaaatctccgcccagcccagaattacagggt
cccccatcgacagagaaggaagccatactgcggaggctggtggccctgctggaggaggag
gcagaagtcattaaccagaagctggcctcggaccccgccctgcgcagcaagctggtccgc
ctgtcctccgactctttcgcccgcctggtggagctgttctgtagccgggatgacagctct
cgcccaagccgagcatgccccgggcccccgcctccttccccggagcccctggcccgcctg
gccctagccatggagctgagccggcgcgtggccgggctggggggcaccctggccggactc
agcgtggagcacgtgcacagcttcacgccctggatccaggcccacgggggctgggagggc
atcctggctgtttcacccgtggacttgaacttgccattggactga

DBGET integrated database retrieval system