KEGG   Homo sapiens (human): 836Help
Entry
836               CDS       T01001                                 

Gene name
CASP3, CPP32, CPP32B, SCA-1
Definition
(RefSeq) caspase 3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04010  MAPK signaling pathway
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04726  Serotonergic synapse
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05016  Huntington disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05222  Small cell lung cancer
hsa05416  Viral myocarditis
Module
hsa_M00685  Apoptotic machinery
Network
N00098  Intrinsic apoptotic pathway
N00100  BCL2-overexpression to intrinsic apoptotic pathway
N00101  DCC-apoptotic pathway
N00102  Loss of DCC to DCC-apoptotic pathway
N00145  Extrinsic apoptotic pathway
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00164  KSHV vBCL2 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00165  KSHV vIAP to crosstalk between extrinsic and intrinsic apoptotic pathways
N00200  KSHV vIAP to host-cell-protein inhibition
N00268  HBV HBx to host-cell-protein inhibition
N00350  HPV E6 to extrinsic apoptotic pathway
N00351  HPV E6 to extrinsic apoptotic pathway
N00352  HPV E6 to extrinsic apoptotic pathway
N00425  HCMV UL36 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00426  HCMV UL37x1 to crosstalk between extrinsic and intrinsic apoptotic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    836 (CASP3)
   04668 TNF signaling pathway
    836 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    836 (CASP3)
   04215 Apoptosis - multiple species
    836 (CASP3)
   04115 p53 signaling pathway
    836 (CASP3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    836 (CASP3)
   04657 IL-17 signaling pathway
    836 (CASP3)
  09156 Nervous system
   04726 Serotonergic synapse
    836 (CASP3)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    836 (CASP3)
   05206 MicroRNAs in cancer
    836 (CASP3)
   05205 Proteoglycans in cancer
    836 (CASP3)
   05203 Viral carcinogenesis
    836 (CASP3)
   05210 Colorectal cancer
    836 (CASP3)
   05222 Small cell lung cancer
    836 (CASP3)
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    836 (CASP3)
   05012 Parkinson disease
    836 (CASP3)
   05014 Amyotrophic lateral sclerosis (ALS)
    836 (CASP3)
   05016 Huntington disease
    836 (CASP3)
  09165 Cardiovascular diseases
   05416 Viral myocarditis
    836 (CASP3)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    836 (CASP3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    836 (CASP3)
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    836 (CASP3)
   05133 Pertussis
    836 (CASP3)
   05134 Legionellosis
    836 (CASP3)
   05152 Tuberculosis
    836 (CASP3)
   05161 Hepatitis B
    836 (CASP3)
   05168 Herpes simplex infection
    836 (CASP3)
   05163 Human cytomegalovirus infection
    836 (CASP3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    836 (CASP3)
   05165 Human papillomavirus infection
    836 (CASP3)
   05146 Amoebiasis
    836 (CASP3)
   05145 Toxoplasmosis
    836 (CASP3)
  09168 Drug resistance
   01524 Platinum drug resistance
    836 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    836 (CASP3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     836 (CASP3)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   836 (CASP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 836
NCBI-ProteinID: NP_004337
OMIM: 600636
HGNC: 1504
Ensembl: ENSG00000164305
Vega: OTTHUMG00000133681
Pharos: P42574(Tchem)
UniProt: P42574
Structure
PDB: 

Position
4q35.1
AA seq 277 aa AA seqDB search
MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTG
MTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLS
HGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDD
DMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVN
RKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggagaacactgaaaactcagtggattcaaaatccattaaaaatttggaaccaaagatc
atacatggaagcgaatcaatggactctggaatatccctggacaacagttataaaatggat
tatcctgagatgggtttatgtataataattaataataagaattttcataaaagcactgga
atgacatctcggtctggtacagatgtcgatgcagcaaacctcagggaaacattcagaaac
ttgaaatatgaagtcaggaataaaaatgatcttacacgtgaagaaattgtggaattgatg
cgtgatgtttctaaagaagatcacagcaaaaggagcagttttgtttgtgtgcttctgagc
catggtgaagaaggaataatttttggaacaaatggacctgttgacctgaaaaaaataaca
aactttttcagaggggatcgttgtagaagtctaactggaaaacccaaacttttcattatt
caggcctgccgtggtacagaactggactgtggcattgagacagacagtggtgttgatgat
gacatggcgtgtcataaaataccagtggaggccgacttcttgtatgcatactccacagca
cctggttattattcttggcgaaattcaaaggatggctcctggttcatccagtcgctttgt
gccatgctgaaacagtatgccgacaagcttgaatttatgcacattcttacccgggttaac
cgaaaggtggcaacagaatttgagtccttttcctttgacgctacttttcatgcaaagaaa
cagattccatgtattgtttccatgctcacaaaagaactctatttttatcactaa

DBGET integrated database retrieval system