KEGG   Homo sapiens (human): 8362Help
Entry
8362              CDS       T01001                                 

Gene name
HIST1H4K, H4/d, H4F2iii, H4FD, dJ160A22.1
Definition
(RefSeq) histone cluster 1 H4 family member k
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    8362 (HIST1H4K)
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    8362 (HIST1H4K)
  09165 Substance dependence
   05034 Alcoholism
    8362 (HIST1H4K)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8362 (HIST1H4K)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    8362 (HIST1H4K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Motif
Other DBs
NCBI-GeneID: 8362
NCBI-ProteinID: NP_003532
OMIM: 602825
HGNC: 4784
Ensembl: ENSG00000273542
Vega: OTTHUMG00000014488
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
6p22.1
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtctggccgcggcaaaggcgggaagggtcttggcaaaggcggcgctaagcgccaccgt
aaagtactgcgcgacaatatccagggcatcaccaagccggccatccggcgccttgctcgc
cgcggcggcgtgaagcgcatctccggcctcatctacgaggagactcgcggggtgctgaag
gtgttcctggagaacgtgatccgggacgccgtgacctatacagagcacgccaagcgcaag
acggtcaccgccatggatgtggtctacgcgctcaagcgccagggccgcaccctctacggt
ttcggtggttga

DBGET integrated database retrieval system