KEGG   Homo sapiens (human): 83638
Entry
83638             CDS       T01001                                 
Symbol
C11orf68, BLES03, P5326
Name
(RefSeq) chromosome 11 open reading frame 68
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF1917
Other DBs
NCBI-GeneID: 83638
NCBI-ProteinID: NP_113638
HGNC: 28801
Ensembl: ENSG00000175573
Pharos: Q9H3H3(Tdark)
UniProt: Q9H3H3
Structure
Position
11:complement(65916810..65919062)
AA seq 292 aa
MAAAAAAAVAGVGRGGGGAEPRQERSRARGWAGVERSEGRRMEPGEELEEEGSPGGREDG
FTAEHLAAEAMAADMDPWLVFDARTTPATELDAWLAKYPPSQVTRYGDPGSPNSEPVGWI
AVYGQGYSPNSGDVQGLQAAWEALQTSGRPITPGTLRQLAITHHVLSGKWLMHLAPGFKL
DHAWAGIARAVVEGQLQVAKVSPRAKEGGRQVICVYTDDFTDRLGVLEADSAIRAAGIKC
LLTYKPDVYTYLGIYRANRWHLCPTLYESRFQLGGSARGSRVLDRANNVELT
NT seq 879 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggccgtggcgggggtggggcgcggtggcggtggcgcggag
ccacggcaggagcggagccgggcccggggctgggccggcgtcgaacgcagcgaaggccgg
aggatggaaccaggtgaggagctggaagaggagggctctccaggtggccgtgaggatggc
ttcaccgccgagcacctggctgcagaggccatggcagctgacatggacccctggctagtg
tttgatgcccgcacaacgcctgccactgagctggatgcctggctggccaagtacccacca
tcccaagttacccgctatggggaccccggttcacccaactcagagcctgtgggctggatt
gcagtgtatgggcagggctacagccccaactccggggacgtgcagggcctgcaggcagcc
tgggaagctctgcagaccagtgggcggcccatcacaccgggtaccctgcgccagctcgcc
atcacccaccacgtgctctcgggcaagtggcttatgcatctggcaccgggcttcaagctg
gaccacgcctgggctggcattgcccgggccgtggttgaaggccagcttcaggtggccaag
gtgagcccacgtgccaaggagggtgggcgccaggtcatctgtgtttacacggacgacttc
acggaccgcttgggtgtactggaggcggattcagccatccgtgcagcgggcattaagtgc
ctgctcacctacaagcctgatgtctacacctacctgggcatctaccgggccaatcgctgg
cacctctgccccactctctatgagagccgtttccagcttgggggtagtgcccgtggctcc
cgagtgcttgaccgtgccaacaacgtggaactgacctag

DBGET integrated database retrieval system