KEGG   Homo sapiens (human): 83650
Entry
83650             CDS       T01001                                 

Symbol
SLC35G5, AMAC, AMAC1L2
Name
(RefSeq) solute carrier family 35 member G5
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-GeneID: 83650
NCBI-ProteinID: NP_473369
OMIM: 615199
HGNC: 15546
Ensembl: ENSG00000177710
Vega: OTTHUMG00000090653
Pharos: Q96KT7(Tdark)
UniProt: Q96KT7
Position
8p23.1
AA seq 338 aa
MAGSHPYFNLPDSTHPSPPSAPPSLRWHQRCQPSGATNGLLVALLGGGLPAGFVGPLSRM
AYQGSNLPSLELLICRCLFHLPIALLLKLRGDPLLGPPDIRGWACFCALLNVLSIGCAYS
AVQVVPAGNAATVRKGSSTVCSAVLTLCLESQGLGGYEWCGLLGSILGLIIILGPGLWTL
QEGTTGVYTTLGYVQAFLGGLALSLGLLVYRSLHFPSCLPTVAFLSGLVGLLGCVPGLFV
LQTPVLPSDLLSWSCVGAEGILALVSFTCVGYAVTKAHPALVCAVLHSEVVVALILQYYM
LHETVALSDIMGAGVVLGSIAIITARNLSCERTGKVEE
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggctggcagtcacccctacttcaacctgcctgactccacacacccatcgccgccctcc
gctccacccagcctccgctggcaccagcgctgccagccctctggtgccaccaatggcctg
ctggtggccctgctgggtgggggcctgcctgctggcttcgtgggccccctttctcgtatg
gcttaccagggttccaacctgccctcgctggagctgctcatctgtcgatgcctcttccac
ctccctattgccctgctacttaaactgcgtggcgacccccttctgggacctcctgacatc
cgaggctgggcctgcttctgtgccctgctcaacgtcctcagcattggatgtgcctacagt
gcagttcaggtggtgcccgctggcaacgctgccactgttcgcaaaggttcttccaccgta
tgctccgctgtcctcaccctctgccttgagagccagggtctcggtggctacgagtggtgt
ggactgttgggcagcatcctaggactaatcatcattctgggacctggactctggacacta
caggaggggaccacaggtgtctacaccaccctgggctatgtgcaggctttcctgggaggc
ctggcgctgtccctggggcttctggtctatcgttctctgcactttccctcctgcctccca
acagtggccttcctatctggcttggtggggctgctgggctgtgtgccaggcctctttgtg
ctgcagacccccgtgttgcccagtgacctcctgagttggagttgtgtgggggcagagggg
atcctcgccttggtctccttcacatgtgtgggctatgcggtcaccaaggcccaccctgcc
ctggtgtgcgctgtcctgcattccgaggtggttgtggcccttatactgcagtattatatg
ctccatgagactgtggcactttctgacatcatgggggcaggggttgtgctgggcagcatt
gccatcattacagcccggaacctcagctgtgagaggacagggaaggtggaggagtga

DBGET integrated database retrieval system