KEGG   Homo sapiens (human): 83666
Entry
83666             CDS       T01001                                 
Symbol
PARP9, ARTD9, BAL, BAL1, MGC:7868
Name
(RefSeq) poly(ADP-ribose) polymerase family member 9
  KO
K15260  poly [ADP-ribose] polymerase 9 [EC:2.4.2.30]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    83666 (PARP9)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     83666 (PARP9)
SSDB
Motif
Pfam: Macro PARP
Other DBs
NCBI-GeneID: 83666
NCBI-ProteinID: NP_001139574
OMIM: 612065
HGNC: 24118
Ensembl: ENSG00000138496
Vega: OTTHUMG00000159522
Pharos: Q8IXQ6(Tbio)
UniProt: Q8IXQ6
Structure
Position
3:complement(122527924..122564784)
AA seq 854 aa
MDFSMVAGAAAYNEKSGRITSLSLLFQKVFAQIFPQWRKGNTEECLPYKCSETGALGENY
SWQIPINHNDFKILKNNERQLCEVLQNKFGCISTLVSPVQEGNSKSLQVFRKMLTPRIEL
SVWKDDLTTHAVDAVVNAANEDLLHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEI
AVTGAGRLPCKQIIHAVGPRWMEWDKQGCTGKLQRAIVSILNYVIYKNTHIKTVAIPALS
SGIFQFPLNLCTKTIVETIRVSLQGKPMMSNLKEIHLVSNEDPTVAAFKAASEFILGKSE
LGQETTPSFNAMVVNNLTLQIVQGHIEWQTADVIVNSVNPHDITVGPVAKSILQQAGVEM
KSEFLATKAKQFQRSQLVLVTKGFNLFCKYIYHVLWHSEFPKPQILKHAMKECLEKCIEQ
NITSISFPALGTGNMEIKKETAAEILFDEVLTFAKDHVKHQLTVKFVIFPTDLEIYKAFS
SEMAKRSKMLSLNNYSVPQSTREEKRENGLEARSPAINLMGFNVEEMYEAHAWIQRILSL
QNHHIIENNHILYLGRKEHDILSQLQKTSSVSITEIISPGRTELEIEGARADLIEVVMNI
EDMLCKVQEEMARKKERGLWRSLGQWTIQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQ
FEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGF
QRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIV
PPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFA
QHPWRGFASGSPVD
NT seq 2565 nt   +upstreamnt  +downstreamnt
atggacttttccatggtggccggagcagcagcttacaatgaaaaatcaggtaggattacc
tcgctctcactcttgtttcagaaagtctttgctcagatctttcctcagtggagaaagggg
aatacagaagaatgtctcccctacaagtgctcagagactggtgctcttggagaaaactat
agttggcaaattcccattaaccacaatgacttcaaaattttaaaaaataatgagcgtcag
ctgtgtgaagtcctccagaataagtttggctgtatctctaccctggtctctccagttcag
gaaggcaacagcaaatctctgcaagtgttcagaaaaatgctgactcctaggatagagtta
tcagtctggaaagatgacctcaccacacatgctgttgatgctgtggtgaatgcagccaat
gaagatcttctgcatgggggaggcctggccctggccctggtaaaagctggtggatttgaa
atccaagaagagagcaaacagtttgttgccagatatggtaaagtgtcagctggtgagata
gctgtcacgggagcagggaggcttccctgcaaacagatcatccatgctgttgggcctcgg
tggatggaatgggataaacagggatgtactggaaagctgcagagggccattgtaagtatt
ctgaattatgtcatctataaaaatactcacattaagacagtagcaattccagccttgagc
tctgggatttttcagttccctctgaatttgtgtacaaagactattgtagagactatccgg
gttagtttgcaagggaagccaatgatgagtaatttgaaagaaattcacctggtgagcaat
gaggaccctactgttgctgcctttaaagctgcttcagaattcatcctagggaagagtgag
ctgggacaagaaaccaccccttctttcaatgcaatggtcgtgaacaacctgaccctccag
attgtccagggccacattgaatggcagacggcagatgtaattgttaattctgtaaaccca
catgatattacagttggacctgtggcaaagtcaattctacaacaagcaggagttgaaatg
aaatcggaatttcttgccacaaaggctaaacagtttcaacggtcccagttggtactggtc
acaaaaggatttaacttgttctgtaaatatatataccatgtactgtggcattcagaattt
cctaaacctcagatattaaaacatgcaatgaaggagtgtttggaaaaatgcattgagcaa
aatataacttccatttcctttcctgcccttgggactggaaacatggaaataaagaaggaa
acagcagcagagattttgtttgatgaagttttaacatttgccaaagaccatgtaaaacac
cagttaactgtaaaatttgtgatctttccaacagatttggagatatataaggctttcagt
tctgaaatggcaaagaggtccaagatgctgagtttgaacaattacagtgtcccccagtca
accagagaggagaaaagagaaaatgggcttgaagctagatctcctgccatcaatctgatg
ggattcaacgtggaagagatgtatgaggcccacgcatggatccaaagaatcctgagtctc
cagaaccaccacatcattgagaataatcatattctgtaccttgggagaaaggaacatgac
attttgtctcagcttcagaaaacttcaagtgtctccatcacagaaattatcagcccagga
aggacagagttagagattgaaggagcccgggctgacctcattgaggtggttatgaacatt
gaagatatgctttgtaaagtacaggaggaaatggcaaggaaaaaggagcgaggcctttgg
cgctcgttaggacagtggactattcagcaacaaaaaacccaagacgaaatgaaagaaaat
atcatatttctgaaatgtcctgtgcctccaactcaagagcttctagatcaaaagaaacag
tttgaaaaatgtggtttgcaggttctaaaggtggagaagatagacaatgaggtccttatg
gctgcctttcaaagaaagaagaaaatgatggaagaaaaactgcacaggcaacctgtgagc
cataggctgtttcagcaagtcccataccagttctgcaatgtggtatgcagagttggcttt
caaagaatgtactcgacaccttgcgatccaaaatacggagctggcatatacttcaccaag
aacctcaaaaacctggcagagaaggccaagaaaatctctgctgcagataagctgatctat
gtgtttgaggctgaagtactcacaggcttcttctgccagggacatccgttaaatattgtt
cccccaccactgagtcctggagctatagatggtcatgacagtgtggttgacaatgtctcc
agccctgaaacctttgttatttttagtggcatgcaggctatacctcagtatttgtggaca
tgcacccaggaatatgtacagtcacaagattactcatcaggaccaatgagaccctttgca
cagcatccttggaggggattcgcaagtggcagccctgttgattaa

DBGET integrated database retrieval system