KEGG   Homo sapiens (human): 83667Help
Entry
83667             CDS       T01001                                 

Gene name
SESN2, HI95, SES2, SEST2
Definition
(RefSeq) sestrin 2
  KO
K20394  sestrin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04150  mTOR signaling pathway
hsa04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    83667 (SESN2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    83667 (SESN2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    83667 (SESN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PA26 CMD DUF1752
Motif
Other DBs
NCBI-GeneID: 83667
NCBI-ProteinID: NP_113647
OMIM: 607767
HGNC: 20746
Ensembl: ENSG00000130766
Vega: OTTHUMG00000003532
Pharos: P58004(Tbio)
UniProt: P58004
Structure
PDB: 

Position
1p35.3
AA seq 480 aa AA seqDB search
MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVEEVLREGAES
LEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLLHTDGPLASSWRHYIAIMAA
ARHQCSYLVGSHMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQA
LLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSP
PSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPS
ADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGG
QLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERN
LKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtggcggactccgagtgccgcgcagagctcaaggactacctgcggttcgccccg
ggcggcgtcggcgactcgggccccggagaggagcagagggagagccgggctcggcgaggc
cctcgagggcccagcgccttcatccccgtggaggaggtccttcgggagggggctgagagc
ctcgagcagcacctggggctggaggcactgatgtcctctgggcgagtagacaacctggca
gtggtgatgggcctgcaccctgactactttaccagcttctggcgcctgcactacctgctg
ctgcacacggatggtcccttggccagctcctggcgccactacattgccatcatggctgcc
gcccgccatcagtgttcttacctggtaggctcccacatggccgagtttctgcagactggt
ggtgaccctgagtggctgctgggcctccaccgggcccccgagaagctgcgcaaactcagc
gagatcaacaagttgctggcgcatcggccatggctcatcaccaaggaacacatccaggcc
ttgctgaagaccggcgagcacacttggtccctggccgagctcattcaggctctggtcctg
ctcacccactgccactcgctctcctccttcgtgtttggctgtggcatcctccctgagggg
gatgcagatggcagccctgccccccaggcacctacaccccctagtgaacagagcagcccc
ccaagcagggacccgttgaacaactctgggggctttgagtctgcccgcgacgtggaggcg
ctgatggagcgcatgcagcagctgcaggagagcctgctgcgggatgaggggacgtcccag
gaggagatggagagccgctttgagctggagaagtcagagagcctgctggtgaccccctca
gctgacatcctggagccctctccacacccagacatgctgtgctttgtggaagaccctact
ttcggatatgaggacttcactcggagaggggctcaggcaccccctaccttccgggcccag
gattatacctgggaagaccatggctactcgctgatccagcggctttaccctgagggtggg
cagctgctggatgagaagttccaggcagcctatagcctcacctacaataccatcgccatg
cacagtggtgtggacacctccgtgctccgcagggccatctggaactatatccactgcgtc
tttggcatcagatatgatgactatgattatggggaggtgaaccagctcctggagcggaac
ctcaaggtctatatcaagacagtggcctgctacccagagaagaccacccgaagaatgtac
aacctcttctggaggcacttccgccactcagagaaggtccacgtgaacttgctgctcctg
gaggcgcgcatgcaagccgctctgctgtacgccctccgtgccatcacccgctacatgacc
tga

DBGET integrated database retrieval system