KEGG   Homo sapiens (human): 83694
Entry
83694             CDS       T01001                                 
Symbol
RPS6KL1, RSKL2
Name
(RefSeq) ribosomal protein S6 kinase like 1
  KO
K20839  ribosomal protein S6 kinase-like
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    83694 (RPS6KL1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   83694 (RPS6KL1)
SSDB
Motif
Pfam: Pkinase MIT PK_Tyr_Ser-Thr ABC1 APH
Other DBs
NCBI-GeneID: 83694
NCBI-ProteinID: NP_113652
HGNC: 20222
Ensembl: ENSG00000198208
Pharos: Q9Y6S9(Tdark)
UniProt: Q9Y6S9 B4DSP6
Position
14:complement(74903951..74923260)
AA seq 549 aa
MSLVACECLPSPGLEPEPCSRARSQAHVYLEQIRNRVALGVPDMTKRDYLVDAATQIRLA
LERDVSEDYEAAFNHYQNGVDVLLRGIHVDPNKERREAVKLKITKYLRRAEEIFNCHLQR
PLSSGASPSAGFSSLRLRPIRTLSSAVEQLRGCRVVGVIEKVQLVQDPATGGTFVVKSLP
RCHMVSRERLTIIPHGVPYMTKLLRYFVSEDSIFLHLEHVQGGTLWSHLLSQAHSRHSGL
SSGSTQERMKAQLNPHLNLLTPARLPSGHAPGQDRIALEPPRTSPNLLLAGEAPSTRPQR
EAEGEPTARTSTSGSSDLPKAPGGHLHLQARRAGQNSDAGPPRGLTWVPEGAGPVLGGCG
RGMDQSCLSADGAGRGCGRATWSVREEQVKQWAAEMLVALEALHEQGVLCRDLHPGNLLL
DQAGHIRLTYFGQWSEVEPQCCGEAVDNLYSAPEVGGISELTEACDWWSFGSLLYELLTG
MALSQSHPSGIQAHTQLQLPEWLSRPAASLLTELLQFEPTRRLGMGEGGVSKLKSHPFFS
TIQWSKLVG
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgagcctggtggcctgtgagtgcctgcccagccccggcctggagcctgagccttgctca
cgagcacggtcccaagctcacgtgtacctggagcagattcgcaacagggtggctctggga
gtgcctgacatgacaaaacgtgactatctggtggatgcggccacgcagatccggctggcc
ctggagcgcgatgttagtgaggactatgaggcggccttcaaccactatcagaatggcgtg
gacgtgctgctccgtggcatacacgttgaccccaacaaggagcgacgtgaggctgtgaag
ctgaaaattaccaaatacctgcggcgggcagaggagatcttcaactgccacctgcagcgg
ccgctgagcagtggagccagccccagcgcgggtttcagcagcctgaggctccggcccatt
cgcacgctgagctctgccgtggagcagctgaggggctgcagggtggtcggggtcatcgag
aaggtgcagctggtccaggacccggcaaccggagggacctttgtggtgaagagcctaccc
aggtgccacatggtgagcagggagcggctgaccatcatcccacacggagtcccctacatg
acgaagctgctcaggtactttgtgagcgaggactccatcttcctgcacctggagcatgtg
caaggaggcactctctggtcccacctgctctcccaggcgcactcccgacattctgggctc
agctctggctctacccaggagaggatgaaggctcagctcaacccccacctcaacctcctg
accccagcgaggcttccctcaggccatgcccctggccaggacagaatcgccctggagcct
cctaggacttctccgaaccttctcctagctggggaggccccatccaccagaccccagagg
gaggctgaaggtgaacccacagccaggaccagcacctctggctcctcggaccttccaaag
gccccaggtggccacctgcaccttcaagctaggagggctggccagaactcagacgctggg
ccccctcgggggctcacttgggttcctgagggggccggcccggtgctagggggctgtggc
cgaggcatggatcagagctgcctgtcagcagatggggccggccggggctgtggcagggcc
acctggagtgtgagagaggagcaggtgaagcagtgggcggcagagatgctggtagcgctg
gaggcgctgcacgagcagggggtgctgtgccgggacctccaccccgggaacctgctcctg
gaccaggcaggtcacatccggctcacatattttggccagtggtcagaggtggagccccag
tgctgcggggaggccgtggacaatctctacagcgccccagaggtgggtgggatttccgag
ctgacggaagcctgtgactggtggagctttgggtctctactgtatgaactgctgacggga
atggcactgtcccagagccacccttcaggaatccaggcccacacccagctccagctgccc
gagtggctcagtcgcccagcggcctctctgctgactgagctgctgcagttcgagcctacc
cggcgcctgggcatgggagaaggtggtgtcagcaaactcaagtcccatccctttttcagt
accatccaatggagcaagctggtggggtaa

DBGET integrated database retrieval system