KEGG   Homo sapiens (human): 83695Help
Entry
83695             CDS       T01001                                 

Gene name
RHNO1, C12orf32, HKMT1188, RHINO
Definition
(RefSeq) RAD9-HUS1-RAD1 interacting nuclear orphan 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: RHINO
Motif
Other DBs
NCBI-GeneID: 83695
NCBI-ProteinID: NP_001239428
OMIM: 614085
HGNC: 28206
Ensembl: ENSG00000171792
Vega: OTTHUMG00000158557
Pharos: Q9BSD3(Tbio)
UniProt: Q9BSD3
Position
12p13.33
AA seq 238 aa AA seqDB search
MPPRKKRRQPSQKAPLLFHQQPLEGPKHSCASTQLPITHTRQVPSKPIDHSTITSWVSPD
FDTAAGSLFPAYQKHQNRARHSSRKPTTSKFPHLTFESPQSSSSETLGIPLIRECPSESE
KDVSRRPLVPVLSPQSCGNMSVQALQSLPYVFIPPDIQTPESSSVKEELIPQDQKENSLL
SCTLHTGTPNSPEPGPVLVKDTPEDKYGIKVTWRRRQHLLAYLRERGKLSRSQFLVKS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccagaaaaaaacgccgccagccttcccagaaagccccgctgctgttccaccaa
caaccactggagggccccaaacacagctgtgcatctacacagcttcccatcactcacact
cgacaggtgcccagcaagcccattgaccacagcaccatcacttcctgggtatcacctgat
tttgatacagcagcaggaagcttgttcccagcctaccagaaacaccaaaaccgggcgaga
cactcaagtcgaaaacctaccacctccaagtttccacatctaacttttgagagtccgcaa
tcttccagttcagagacattggggatccccttaatccgagagtgccccagtgaatcagaa
aaggatgtttccagaagacccttagttccagtgctcagtccccaaagctgtgggaacatg
tcagtgcaggcacttcagagcttaccttatgtgttcattccacctgatatccagacccca
gagtcatcgtctgtgaaggaagaactcattccccaagatcagaaggaaaacagccttcta
agctgcactcttcacactggcactcctaatagcccagagcctggacctgttctggttaaa
gacacccccgaggacaagtatggaataaaggtcacatggaggagacgacagcacctgctt
gcttacctcagggagagagggaagctgagcagaagccaattccttgtgaaaagctga

DBGET integrated database retrieval system