KEGG   Homo sapiens (human): 83696Help
Entry
83696             CDS       T01001                                 

Gene name
TRAPPC9, IBP, IKBKBBP, MRT13, NIBP, T1, TRS120
Definition
(RefSeq) trafficking protein particle complex 9
  KO
K20306  trafficking protein particle complex subunit 9
Organism
hsa  Homo sapiens (human)
Disease
H00768  Autosomal recessive mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    83696 (TRAPPC9)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    83696 (TRAPPC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAPPC9-Trs120 Vps23_core PMBR
Motif
Other DBs
NCBI-GeneID: 83696
NCBI-ProteinID: NP_001153844
OMIM: 611966
HGNC: 30832
Ensembl: ENSG00000167632
Vega: OTTHUMG00000164187
Pharos: Q96Q05(Tbio)
UniProt: Q96Q05
Position
8q24.3
AA seq 1148 aa AA seqDB search
MSVPDYMQCAEDHQTLLVVVQPVGIVSEENFFRIYKRICSVSQISVRDSQRVLYIRYRHH
YPPENNEWGDFQTHRKVVGLITITDCFSAKDWPQTFEKFHVQKEIYGSTLYDSRLFVFGL
QGEIVEQPRTDVAFYPNYEDCQTVEKRIEDFIESLFIVLESKRLDRATDKSGDKIPLLCV
PFEKKDFVGLDTDSRHYKKRCQGRMRKHVGDLCLQAGMLQDSLVHYHMSVELLRSVNDFL
WLGAALEGLCSASVIYHYPGGTGGKSGARRFQGSTLPAEAANRHRPGAQEVLIDPGALTT
NGINPDTSTEIGRAKNCLSPEDIIDKYKEAISYYSKYKNAGVIELEACIKAVRVLAIQKR
SMEASEFLQNAVYINLRQLSEEEKIQRYSILSELYELIGFHRKSAFFKRVAAMQCVAPSI
AEPGWRACYKLLLETLPGYSLSLDPKDFSRGTHRGWAAVQMRLLHELVYASRRMGNPALS
VRHLSFLLQTMLDFLSDQEKKDVAQSLENYTSKCPGTMEPIALPGGLTLPPVPFTKLPIV
RHVKLLNLPASLRPHKMKSLLGQNVSTKSPFIYSPIIAHNRGEERNKKIDFQWVQGDVCE
VQLMVYNPMPFELRVENMGLLTSGVEFESLPAALSLPAESGLYPVTLVGVPQTTGTITVN
GYHTTVFGVFSDCLLDNLPGIKTSGSTVEVIPALPRLQISTSLPRSAHSLQPSSGDEIST
NVSVQLYNGESQQLIIKLENIGMEPLEKLEVTSKVLTTKEKLYGDFLSWKLEETLAQFPL
QPGKVATFTINIKVKLDFSCQENLLQDLSDDGISVSGFPLSSPFRQVVRPRVEGKPVNPP
ESNKAGDYSHVKTLEAVLNFKYSGGPGHTEGYYRNLSLGLHVEVEPSVFFTRVSTLPATS
TRQCHLLLDVFNSTEHELTVSTRSSEALILHAGECQRMAIQVDKFNFESFPESPGEKGQF
ANPKQLEEERREARGLEIHSKLGICWRIPSLKRSGEASVEGLLNQLVLEHLQLAPLQWDV
LVDGQPCDREAVAACQVGDPVRLEVRLTNRSPRSVGPFALTVVPFQDHQNGVHNYDLHDT
VSFVGSSTFYLDAVQPSGQSACLGALLFLYTGDFFLHIRFHEDSTSKELPPSWFCLPSVH
VCALEAQA
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccctgactacatgcagtgtgctgaggaccaccagacgctgctcgtggtggtc
cagcctgtgggcatcgtctccgaggagaacttcttcaggatctataagaggatttgctct
gtgagtcagatcagcgtgcgggactcccagcgagtcctctacatccgctacaggcaccac
tacccacccgagaacaacgagtggggtgacttccagacccaccgcaaagtcgtgggcctc
atcaccatcacagactgcttctcggccaaggactggccacagacctttgagaagttccac
gtgcagaaggagatctacggctccacactgtatgactcccggctctttgtcttcgggctg
cagggggagatcgtggagcagccgcgcaccgacgtggctttctaccccaactacgaggac
tgccagacggtggagaagagaatcgaggacttcatcgagtcactgttcatcgtgctggag
tccaagcgtctggacagagccacagacaagtctggggataagatcccccttctctgtgtc
ccgtttgagaaaaaggactttgtaggactggacacagacagcagacattacaagaagcgg
tgccaaggccgcatgcggaagcacgtgggggacctgtgcctgcaggcagggatgctgcag
gactccctggtgcattaccacatgtcggtggagctgctgcgttctgtgaatgactttctg
tggcttggagctgccctggaaggattgtgttcagcttctgtcatctatcactatcctggt
ggaactggtgggaagagtggagctcggaggttccagggcagcacccttcctgctgaagca
gccaatagacaccggccaggggcacaggaagttctcattgatccaggtgccctcaccacc
aatggcatcaaccctgacaccagtactgagatcggacgtgctaagaactgccttagccct
gaagacataattgacaagtataaagaggcgatttcctattacagcaagtataagaatgcg
ggagtgattgagttggaagcgtgcatcaaggctgtacgtgtccttgcaattcagaaacgg
agcatggaagcatcagaatttcttcagaatgcagtttacattaaccttcgacagctttct
gaggaagagaaaattcagcgctacagcatcctctccgagctctatgagctgatcggcttc
catcgcaagtctgcgttcttcaagcgcgtggccgccatgcagtgcgtggccccaagcatc
gcggagcctgggtggagggcctgctacaaactcctcctggaaacgctgcccggctacagt
ctgtcgctggatcccaaagatttcagcagaggcacgcacagaggctgggctgcggtccag
atgcgtttgctccatgaattggtctacgcctcccgaaggatggggaaccctgccctctct
gtcagacacctgtccttccttctacagaccatgctggacttcttgtcggatcaggaaaag
aaagatgtggcccaaagcctagagaactatacgtccaagtgtcctgggaccatggagccc
atcgccctccctggcggcctcaccctgccaccggtgcccttcaccaagcttcccatcgtc
aggcatgtgaaactattgaaccttcctgctagcctccggccacacaaaatgaaaagcttg
ctgggtcagaacgtgtcaaccaaaagtcctttcatctattcaccaattatcgcacacaac
cgtggagaagagcggaacaagaaaatagatttccagtgggttcaaggagatgtgtgtgaa
gttcagctgatggtatataacccaatgccgtttgaacttcgagttgaaaacatggggctg
ctcaccagcggagtggagttcgagtctctccctgcggcgctttctcttccggctgaatct
ggtctgtacccagtgacgctcgtcggggtcccgcagacgactggaacgattactgtgaac
ggttaccataccacggtcttcggtgtgttcagtgactgtttgctggataacctgccggga
ataaaaaccagtggctccacagtggaagtcattcccgcgttgccaagactgcagatcagc
acctctctgcccagatctgcacattcattgcaaccttcttctggtgatgaaatatctact
aatgtatctgtccagctttacaatggagaaagtcagcaactaatcattaaattggaaaat
attggaatggaaccattggagaaactggaggtcacctcgaaagttctcaccactaaagaa
aaattgtatggcgacttcttgagctggaagctagaggaaacccttgcccagttccctttg
cagcctgggaaggtggccacgttcacaatcaacatcaaagtgaagctggatttctcctgc
caggagaatctcctgcaggatctcagtgatgatggaatcagtgtgagtggctttcccctg
tccagtccttttcggcaggtcgttcggccccgagtggagggcaaacctgtgaacccaccc
gagagcaacaaagcaggcgactacagccacgtgaagaccctggaagctgtcctgaatttc
aaatactctggaggcccgggccacactgaaggatattacaggaatctctccctggggctg
catgtagaagtcgagccgtctgtatttttcacccgagtcagcaccctcccagcaaccagt
acccggcagtgtcacctgctcctggatgtcttcaactccaccgagcatgagctgaccgtc
agcaccaggagcagcgaggcactcatcctgcacgccggtgagtgccagcgaatggctatt
caagtggacaagttcaactttgagagtttcccggagtcccctggggagaaggggcaattt
gcaaaccccaagcagctggaggaagagcggcgggaagcccgaggcctggagatccacagc
aagctgggcatctgctggagaatcccctccctgaagcgcagtggcgaggcgagtgtggaa
ggactcctgaaccagctcgtcctggagcacctgcagctggcgcctctgcagtgggatgtg
ctggtggacggacagccatgtgaccgcgaggctgtggcggcctgccaggtgggcgacccc
gtgcgcctggaggtgcggctgaccaaccggagcccgcgcagcgtagggcccttcgccctc
actgtggtccccttccaggaccaccagaacggcgtgcacaactacgacctgcacgacacc
gtctccttcgtgggctccagcaccttctacctcgacgcggtgcagccgtccggccagtcg
gcctgcctcggggccctcctcttcctctacacgggagacttcttcctccacatccggttc
cacgaggacagcaccagcaaggagctgccaccctcttggttctgcctgcccagtgtgcac
gtgtgtgccctggaggcgcaggcctga

DBGET integrated database retrieval system