KEGG   Homo sapiens (human): 837Help
Entry
837               CDS       T01001                                 

Gene name
CASP4, ICE(rel)II, ICEREL-II, ICH-2, Mih1, Mih1/TX, TX
Definition
(RefSeq) caspase 4
  KO
K04394  caspase 4 [EC:3.4.22.57 3.4.22.64]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    837 (CASP4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    837 (CASP4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.57  caspase-4
     837 (CASP4)
    3.4.22.64  caspase-11
     837 (CASP4)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   837 (CASP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD
Motif
Other DBs
NCBI-GeneID: 837
NCBI-ProteinID: NP_001216
OMIM: 602664
HGNC: 1505
Ensembl: ENSG00000196954
Vega: OTTHUMG00000166078
Pharos: P49662(Tchem)
UniProt: P49662
Position
11q22.3
AA seq 377 aa AA seqDB search
MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADS
MQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKE
RAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLT
ARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNN
RNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF
IAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMP
TIERLSMTRYFYLFPGN
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaggcaaccacagaaaaaagccacttaaggtgttggaatccctgggcaaagat
ttcctcactggtgttttggataacttggtggaacaaaatgtactgaactggaaggaagag
gaaaaaaagaaatattacgatgctaaaactgaagacaaagttcgggtcatggcagactct
atgcaagagaagcaacgtatggcaggacaaatgcttcttcaaaccttttttaacatagac
caaatatcccccaataaaaaagctcatccgaatatggaggctggaccacctgagtcagga
gaatctacagatgccctcaagctttgtcctcatgaagaattcctgagactatgtaaagaa
agagctgaagagatctatccaataaaggagagaaacaaccgcacacgcctggctctcatc
atatgcaatacagagtttgaccatctgcctccgaggaatggagctgactttgacatcaca
gggatgaaggagctacttgagggtctggactatagtgtagatgtagaagagaatctgaca
gccagggatatggagtcagcgctgagggcatttgctaccagaccagagcacaagtcctct
gacagcacattcttggtactcatgtctcatggcatcctggagggaatctgcggaactgtg
catgatgagaaaaaaccagatgtgctgctttatgacaccatcttccagatattcaacaac
cgcaactgcctcagtctgaaggacaaacccaaggtcatcattgtccaggcctgcagaggt
gcaaaccgtggggaactgtgggtcagagactctccagcatccttggaagtggcctcttca
cagtcatctgagaacctagaggaagatgctgtttacaagacccacgtggagaaggacttc
attgctttctgctcttcaacgccacacaacgtgtcctggagagacagcacaatgggctct
atcttcatcacacaactcatcacatgcttccagaaatattcttggtgctgccacctagag
gaagtatttcggaaggtacagcaatcatttgaaactccaagggccaaagctcaaatgccc
accatagaacgactgtccatgacaagatatttctacctctttcctggcaattga

DBGET integrated database retrieval system