KEGG   Homo sapiens (human): 837
Entry
837               CDS       T01001                                 
Symbol
CASP4, ICE(rel)II, ICEREL-II, ICH-2, Mih1, Mih1/TX, TX
Name
(RefSeq) caspase 4
  KO
K04394  caspase 4 [EC:3.4.22.57 3.4.22.64]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa04621  NOD-like receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
Network
nt06139  NLR signaling (viruses and bacteria)
  Element
N00934  Non-canonical inflammasome signaling pathway
N00935  Escherichia NleF to non-canonical inflammasome signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    837 (CASP4)
   04621 NOD-like receptor signaling pathway
    837 (CASP4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    837 (CASP4)
   05132 Salmonella infection
    837 (CASP4)
   05131 Shigellosis
    837 (CASP4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    837 (CASP4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.57  caspase-4
     837 (CASP4)
    3.4.22.64  caspase-11
     837 (CASP4)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C14: caspase family
   837 (CASP4)
SSDB
Motif
Pfam: Peptidase_C14 CARD DUF3331
Other DBs
NCBI-GeneID: 837
NCBI-ProteinID: NP_001216
OMIM: 602664
HGNC: 1505
Ensembl: ENSG00000196954
Pharos: P49662(Tchem)
UniProt: P49662
Structure
Position
11:complement(104942866..104968574)
AA seq 377 aa
MAEGNHRKKPLKVLESLGKDFLTGVLDNLVEQNVLNWKEEEKKKYYDAKTEDKVRVMADS
MQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCPHEEFLRLCKE
RAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYSVDVEENLT
ARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDEKKPDVLLYDTIFQIFNN
RNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEKDF
IAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMP
TIERLSMTRYFYLFPGN
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcagaaggcaaccacagaaaaaagccacttaaggtgttggaatccctgggcaaagat
ttcctcactggtgttttggataacttggtggaacaaaatgtactgaactggaaggaagag
gaaaaaaagaaatattacgatgctaaaactgaagacaaagttcgggtcatggcagactct
atgcaagagaagcaacgtatggcaggacaaatgcttcttcaaaccttttttaacatagac
caaatatcccccaataaaaaagctcatccgaatatggaggctggaccacctgagtcagga
gaatctacagatgccctcaagctttgtcctcatgaagaattcctgagactatgtaaagaa
agagctgaagagatctatccaataaaggagagaaacaaccgcacacgcctggctctcatc
atatgcaatacagagtttgaccatctgcctccgaggaatggagctgactttgacatcaca
gggatgaaggagctacttgagggtctggactatagtgtagatgtagaagagaatctgaca
gccagggatatggagtcagcgctgagggcatttgctaccagaccagagcacaagtcctct
gacagcacattcttggtactcatgtctcatggcatcctggagggaatctgcggaactgtg
catgatgagaaaaaaccagatgtgctgctttatgacaccatcttccagatattcaacaac
cgcaactgcctcagtctgaaggacaaacccaaggtcatcattgtccaggcctgcagaggt
gcaaaccgtggggaactgtgggtcagagactctccagcatccttggaagtggcctcttca
cagtcatctgagaacctagaggaagatgctgtttacaagacccacgtggagaaggacttc
attgctttctgctcttcaacgccacacaacgtgtcctggagagacagcacaatgggctct
atcttcatcacacaactcatcacatgcttccagaaatattcttggtgctgccacctagag
gaagtatttcggaaggtacagcaatcatttgaaactccaagggccaaagctcaaatgccc
accatagaacgactgtccatgacaagatatttctacctctttcctggcaattga

DBGET integrated database retrieval system