KEGG   Homo sapiens (human): 8370
Entry
8370              CDS       T01001                                 

Gene name
H4C14, FO108, H4, H4-16, H4/n, H4C1, H4C11, H4C12, H4C13, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, HIST2H4, HIST2H4A
Definition
(RefSeq) H4 clustered histone 14
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8370 (H4C14)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8370 (H4C14)
  09165 Substance dependence
   05034 Alcoholism
    8370 (H4C14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8370 (H4C14)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8370 (H4C14)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8370
NCBI-ProteinID: NP_003539
OMIM: 142750
HGNC: 4794
Ensembl: ENSG00000270882
Vega: OTTHUMG00000012189
Pharos: P62805(Tbio)
UniProt: P62805 B2R4R0
Structure
PDB: 

Position
1q21.2
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtccggcagaggaaagggcggaaaaggcttaggcaaagggggcgctaagcgccaccgc
aaggtcttgagagacaacattcagggcatcaccaagcctgccattcggcgtctagctcgg
cgtggcggcgttaagcggatctctggcctcatttacgaggagacccgcggtgtgctgaag
gtgttcctggagaatgtgattcgggacgcagtcacctacaccgagcacgccaagcgcaag
accgtcacagccatggatgtggtgtacgcgctcaagcgccaggggcgcaccctgtacggc
ttcggaggctag

DBGET integrated database retrieval system