KEGG   Homo sapiens (human): 83700Help
Entry
83700             CDS       T01001                                 

Gene name
JAM3, JAM-2, JAM-3, JAM-C, JAMC
Definition
(RefSeq) junctional adhesion molecule 3
  KO
K06785  junctional adhesion molecule 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Disease
H01301  Hemorrhagic destruction of the brain, subependymal calcification, and cataracts
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    83700 (JAM3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    83700 (JAM3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    83700 (JAM3)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    83700 (JAM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set ig V-set Ig_2 C2-set_2 Izumo-Ig Ig_6 Adeno_E3_CR1 Phage_Coat_B
Motif
Other DBs
NCBI-GeneID: 83700
NCBI-ProteinID: NP_116190
OMIM: 606871
HGNC: 15532
Ensembl: ENSG00000166086
Vega: OTTHUMG00000167130
Pharos: Q9BX67(Tbio)
UniProt: Q9BX67
Position
11q25
AA seq 310 aa AA seqDB search
MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQT
SDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVAR
NDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPL
PTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDL
NIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGESYKNPGKPDGVNYIRTDEEG
DFRHKSSFVI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaggcggccaccgcgactccggctctgcgctcggctgcctgacttcttcctg
ctgctgcttttcaggggctgcctgataggggctgtaaatctcaaatccagcaatcgaacc
ccagtggtacaggaatttgaaagtgtggaactgtcttgcatcattacggattcgcagaca
agtgaccccaggatcgagtggaagaaaattcaagatgaacaaaccacatatgtgtttttt
gacaacaaaattcagggagacttggcgggtcgtgcagaaatactggggaagacatccctg
aagatctggaatgtgacacggagagactcagccctttatcgctgtgaggtcgttgctcga
aatgaccgcaaggaaattgatgagattgtgatcgagttaactgtgcaagtgaagccagtg
acccctgtctgtagagtgccgaaggctgtaccagtaggcaagatggcaacactgcactgc
caggagagtgagggccacccccggcctcactacagctggtatcgcaatgatgtaccactg
cccacggattccagagccaatcccagatttcgcaattcttctttccacttaaactctgaa
acaggcactttggtgttcactgctgttcacaaggacgactctgggcagtactactgcatt
gcttccaatgacgcaggctcagccaggtgtgaggagcaggagatggaagtctatgacctg
aacattggcggaattattgggggggttctggttgtccttgctgtactggccctgatcacg
ttgggcatctgctgtgcatacagacgtggctacttcatcaacaataaacaggatggagaa
agttacaagaacccagggaaaccagatggagttaactacatccgcactgacgaggagggc
gacttcagacacaagtcatcgtttgtgatctga

DBGET integrated database retrieval system