KEGG   Homo sapiens (human): 8372
Entry
8372              CDS       T01001                                 

Gene name
HYAL3, HYAL-3, LUCA-3, LUCA3
Definition
(RefSeq) hyaluronidase 3
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa04142  Lysosome
Module
hsa_M00076  Dermatan sulfate degradation
hsa_M00077  Chondroitin sulfate degradation
Network
nt06012  Glycosaminoglycan degradation
  Element
N00610  Dermatan sulfate degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    8372 (HYAL3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    8372 (HYAL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:hsa02042]
    8372 (HYAL3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    8372 (HYAL3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    8372 (HYAL3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     8372 (HYAL3)
Bacterial toxins [BR:hsa02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   8372 (HYAL3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Enzymes
   8372 (HYAL3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  8372 (HYAL3)
SSDB
Motif
Pfam: Glyco_hydro_56 EGF_2 Peptidase_M29 EGF
Other DBs
NCBI-GeneID: 8372
NCBI-ProteinID: NP_001186958
OMIM: 604038
HGNC: 5322
Ensembl: ENSG00000186792
Vega: OTTHUMG00000156936
Pharos: O43820(Tbio)
UniProt: O43820
Position
3p21.31
AA seq 417 aa
MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNALGIIAN
RGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGF
AGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARAL
MEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSA
LFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDD
LVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQR
CHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgaccacgcaactgggcccagccctggtgctgggggtggccctgtgcctgggttgtggc
cagcccctaccacaggtccctgaacgccccttctctgtgctgtggaatgtaccctcagca
cactgtgaggcccgctttggtgtgcacctgccactcaatgctctgggcatcatagccaac
cgtggccagcattttcacggtcagaacatgaccattttctacaagaaccaactcggcctc
tatccctactttggacccaggggcacagctcacaatgggggcatcccccaggctttgccc
cttgaccgccacctggcactggctgcctaccagatccaccacagcctgagacctggcttt
gctggcccagcagtgctggattgggaggagtggtgtccactctgggctgggaactggggc
cgccgccgagcttatcaggcagcctcttgggcttgggcacagcaggtattccctgacctg
gaccctcaggagcagctctacaaggcctatactggctttgagcaggcggcccgtgcactg
atggaggatacgctgcgggtggcccaggcactacggccccatggactctggggcttctat
cactacccagcctgtggcaatggctggcatagtatggcttccaactataccggccgctgc
catgcagccacccttgcccgcaacactcaactgcattggctctgggccgcctccagtgcc
ctcttccccagcatctacctcccacccaggctgccacctgcccaccaccaggcctttgtc
cgacatcgcctggaggaggccttccgtgtggcccttgttgggcaccgacatcccctgcct
gtcctggcctatgtccgcctcacacaccggagatctgggaggttcctgtcccaggatgac
cttgtgcagtccattggtgtgagtgcagcactaggggcagccggcgtggtgctctggggg
gacctgagcctctccagctctgaggaggagtgctggcatctccatgactacctggtggac
accttgggcccctatgtgatcaatgtgaccagggcagcgatggcctgcagtcaccagcgg
tgccatggccacgggcgctgtgcccggcgagatccaggacagatggaagcctttctacac
ctgtggccagacggcagccttggagattggaagtccttcagctgccactgttactggggc
tgggctggccccacctgccaggagcccaggcctgggcctaaagaagcagtataa

DBGET integrated database retrieval system