KEGG   Homo sapiens (human): 83729Help
Entry
83729             CDS       T01001                                 

Gene name
INHBE
Definition
(RefSeq) inhibin subunit beta E
  KO
K22689  inhibin beta E chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    83729 (INHBE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    83729 (INHBE)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    83729 (INHBE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    83729 (INHBE)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   83729 (INHBE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta Anti-TRAP
Motif
Other DBs
NCBI-GeneID: 83729
NCBI-ProteinID: NP_113667
OMIM: 612031
HGNC: 24029
Ensembl: ENSG00000139269
Vega: OTTHUMG00000169995
Pharos: P58166(Tbio)
UniProt: P58166
Position
12q13.3
AA seq 350 aa AA seqDB search
MRLPDVQLWLVLLWALVRAQGTGSVCPSCGGSKLAPQAERALVLELAKQQILDGLHLTSR
PRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSSLLTFHLSTPRSHH
LYHARLWLHVLPTLPGTLCLRIFRWGPRRRRQGSRTLLAEHHITNLGWHTLTLPSSGLRG
EKSGVLKLQLDCRPLEGNSTVTGQPRRLLDTAGHQQPFLELKIRANEPGAGRARRRTPTC
EPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFS
LLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcggctccctgatgtccagctctggctggtgctgctgtgggcactggtgcgagcacag
gggacagggtctgtgtgtccctcctgtgggggctccaaactggcaccccaagcagaacga
gctctggtgctggagctagccaagcagcaaatcctggatgggttgcacctgaccagtcgt
cccagaataactcatcctccaccccaggcagcgctgaccagagccctccggagactacag
ccagggagtgtggctccagggaatggggaggaggtcatcagctttgctactgtcacagac
tccacttcagcctacagctccctgctcacttttcacctgtccactcctcggtcccaccac
ctgtaccatgcccgcctgtggctgcacgtgctccccacccttcctggcactctttgcttg
aggatcttccgatggggaccaaggaggaggcgccaagggtcccgcactctcctggctgag
caccacatcaccaacctgggctggcataccttaactctgccctctagtggcttgaggggt
gagaagtctggtgtcctgaaactgcaactagactgcagacccctagaaggcaacagcaca
gttactggacaaccgaggcggctcttggacacagcaggacaccagcagcccttcctagag
cttaagatccgagccaatgagcctggagcaggccgggccaggaggaggacccccacctgt
gagcctgcgacccccttatgttgcaggcgagaccattacgtagacttccaggaactggga
tggcgggactggatactgcagcccgaggggtaccagctgaattactgcagtgggcagtgc
cctccccacctggctggcagcccaggcattgctgcctctttccattctgccgtcttcagc
ctcctcaaagccaacaatccttggcctgccagtacctcctgttgtgtccctactgcccga
aggcccctctctctcctctacctggatcataatggcaatgtggtcaagacggatgtgcca
gatatggtggtggaggcctgtggctgcagctag

DBGET integrated database retrieval system