KEGG   Homo sapiens (human): 83732Help
Entry
83732             CDS       T01001                                 

Gene name
RIOK1, AD034, RIO1, RRP10, bA288G3.1
Definition
(RefSeq) RIO kinase 1
  KO
K07178  RIO kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    83732 (RIOK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    83732 (RIOK1)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    83732 (RIOK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     83732 (RIOK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  RIO family [OT]
   83732 (RIOK1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-40S particles
   Kinases
    83732 (RIOK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RIO1 APH Csm1_B
Motif
Other DBs
NCBI-GeneID: 83732
NCBI-ProteinID: NP_113668
OMIM: 617753
HGNC: 18656
Ensembl: ENSG00000124784
Vega: OTTHUMG00000014207
Pharos: Q9BRS2(Tchem)
UniProt: Q9BRS2
Structure
PDB: 

Position
6p24.3
AA seq 568 aa AA seqDB search
MDYRRLLMSRVVPGQFDDADSSDSENRDLKTVKEKDDILFEDLQDNVNENGEGEIEDEEE
EGYDDDDDDWDWDEGVGKLAKGYVWNGGSNPQANRQTSDSSSAKMSTPADKVLRKFENKI
NLDKLNVTDSVINKVTEKSRQKEADMYRIKDKADRATVEQVLDPRTRMILFKMLTRGIIT
EINGCISTGKEANVYHASTANGESRAIKIYKTSILVFKDRDKYVSGEFRFRHGYCKGNPR
KMVKTWAEKEMRNLIRLNTAEIPCPEPIMLRSHVLVMSFIGKDDMPAPLLKNVQLSESKA
RELYLQVIQYMRRMYQDARLVHADLSEFNMLYHGGGVYIIDVSQSVEHDHPHALEFLRKD
CANVNDFFMRHSVAVMTVRELFEFVTDPSITHENMDAYLSKAMEIASQRTKEERSSQDHV
DEEVFKRAYIPRTLNEVKNYERDMDIIMKLKEEDMAMNAQQDNILYQTVTGLKKDLSGVQ
KVPALLENQVEERTCSDSEDIGSSECSDTDSEEQGDHARPKKHTTDPDIDKKERKKMVKE
AQREKRKNKIPKHVKKRKEKTAKTKKGK
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggactaccggcggcttctcatgagccgggtggtccccgggcaattcgacgacgcggac
tcctctgacagtgaaaacagagacttgaagacagtcaaagagaaggatgacattctgttt
gaagaccttcaagacaatgtgaatgagaatggtgaaggtgaaatagaagatgaggaggag
gagggttatgacgatgatgatgatgactgggactgggatgaaggagttggaaaactcgcc
aagggttatgtctggaatggaggaagcaacccacaggcaaatcgacagacctccgacagc
agttcagccaaaatgtctactccagcagacaaggtcttacggaaatttgagaataaaatt
aatttagataagctaaatgttactgattccgtcataaataaagtcaccgaaaagtctaga
caaaaggaagcagatatgtatcgcatcaaagataaggcagacagagcaactgtagaacag
gtgttggatcccagaacaagaatgattttattcaagatgttgactagaggaatcataaca
gagataaatggctgcattagcacaggaaaagaagctaatgtataccatgctagcacagca
aatggagagagcagagcaatcaaaatttataaaacttctattttggtgttcaaagatcgg
gataaatatgtaagtggagaattcagatttcgtcatggctattgtaaaggaaaccctagg
aaaatggtgaaaacttgggcagaaaaagaaatgaggaacttaatcaggctaaacacagca
gagataccatgtccagaaccaataatgctaagaagtcatgttcttgtcatgagtttcatc
ggtaaagatgacatgcctgcaccactcttgaaaaatgtccagttatcagaatccaaggct
cgggagttgtacctgcaggtcattcagtacatgagaagaatgtatcaggatgccagactt
gtccatgcagatctcagtgaatttaacatgctgtaccacggtggaggcgtgtatatcatt
gacgtgtctcagtccgtggagcacgaccacccacatgccttggagttcttgagaaaggat
tgcgccaacgtcaatgatttctttatgaggcacagtgttgctgtcatgactgtgcgggag
ctctttgaatttgtcacagatccatccattacacatgagaacatggatgcttatctctca
aaggccatggaaatagcatctcaaaggaccaaggaagaacggtctagccaagatcatgtg
gatgaagaggtgtttaagcgagcatatattcctagaaccttgaatgaagtgaaaaattat
gagagggatatggacataattatgaaattgaaggaagaggacatggccatgaatgcccaa
caagataatattctataccagactgttacaggattgaagaaagatttgtcaggagttcag
aaggtccctgcactcctagaaaatcaagtggaggaaaggacttgttctgattcagaagat
attggaagctctgagtgctctgacacagactctgaagagcagggagaccatgcccgcccc
aagaaacacaccacggaccctgacattgataaaaaagaaagaaaaaagatggtcaaggaa
gcccagagagagaaaagaaaaaacaaaattcctaaacatgtgaaaaaaagaaaggagaag
acagccaagacgaaaaaaggcaaatag

DBGET integrated database retrieval system