KEGG   Homo sapiens (human): 83733
Entry
83733             CDS       T01001                                 

Gene name
SLC25A18, GC2
Definition
(RefSeq) solute carrier family 25 member 18
  KO
K15107  solute carrier family 25 (mitochondrial glutamate transporter), member 18/22
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    83733 (SLC25A18)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   83733 (SLC25A18)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 83733
NCBI-ProteinID: NP_001290413
OMIM: 609303
HGNC: 10988
Ensembl: ENSG00000182902
Vega: OTTHUMG00000150089
Pharos: Q9H1K4(Tdark)
UniProt: Q9H1K4 A0A024R0W0
Position
22q11.21
AA seq 315 aa
MTHQDLSITAKLINGGVAGLVGVTCVFPIDLAKTRLQNQHGKAMYKGMIDCLMKTARAEG
FFGMYRGAAVNLTLVTPEKAIKLAANDFFRRLLMEDGMQRNLKMEMLAGCGAGMCQVVVT
CPMEMLKIQLQDAGRLAVHHQGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLA
GLYRGLGATLLRDIPFSIIYFPLFANLNNLGFNELAGKASFAHSFVSGCVAGSIAAVAVT
PLDVLKTRIQTLKKGLGEDMYSGITDCARKLWIQEGPSAFMKGAGCRALVIAPLFGIAQG
VYFIGIGERILKCFD
NT seq 948 nt   +upstreamnt  +downstreamnt
atgacccaccaggatctgagcatcacagccaaactcatcaatggaggtgtagcagggctc
gtgggggtgacctgcgtgttccccatcgacttggccaagactcgcctgcagaaccagcat
gggaaagccatgtacaaaggaatgatcgactgcctgatgaagacggctcgggcggagggc
ttcttcggcatgtaccgaggggctgcagtgaacctcactctggtcactccagagaaggcc
atcaagctggcggccaacgactttttccggcggctgctcatggaagatgggatgcagcgg
aacctgaagatggagatgcttgccgggtgtggggctgggatgtgccaggtcgtggtgacc
tgtcccatggaaatgctcaagattcagctgcaggatgctggacgcctggccgtccatcat
cagggctcggcctcagcaccctccacctccaggtcctacacaactggttcggcttccacc
cacaggcgcccctctgccaccctcattgcctgggagctgctccgcactcagggcctggct
gggctctacaggggcctgggtgccactctcctcagagacattcctttctccatcatctac
ttcccactgtttgccaaccttaacaacctggggttcaacgagctcgccggtaaggcgtcc
tttgcacattccttcgtgtcaggctgtgtggcaggttccatagctgcggtcgcagtgacg
cctctagatgttctgaaaactcgaatccaaaccctcaagaaaggcctgggcgaggacatg
tacagtgggatcaccgactgtgccaggaaactctggattcaggagggaccatctgccttc
atgaaaggcgctggctgccgggcactggtcatagcacctctctttgggattgctcaaggg
gtctattttattgggattggagagcgcatcttaaagtgttttgactag

DBGET integrated database retrieval system