KEGG   Homo sapiens (human): 83734Help
Entry
83734             CDS       T01001                                 

Gene name
ATG10, APG10, APG10L, pp12616
Definition
(RefSeq) autophagy related 10
  KO
K17888  ubiquitin-like-conjugating enzyme ATG10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    83734 (ATG10)
   04136 Autophagy - other
    83734 (ATG10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    83734 (ATG10)
   04121 Ubiquitin system [BR:hsa04121]
    83734 (ATG10)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    83734 (ATG10)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    83734 (ATG10)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   83734 (ATG10)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    83734 (ATG10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Autophagy_act_C
Motif
Other DBs
NCBI-GeneID: 83734
NCBI-ProteinID: NP_001124500
OMIM: 610800
HGNC: 20315
Ensembl: ENSG00000152348
Vega: OTTHUMG00000119041
Pharos: Q9H0Y0(Tbio)
UniProt: Q9H0Y0
Position
5q14.1-q14.2
AA seq 220 aa AA seqDB search
MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLG
ASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDG
RPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQ
KINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagatgagttcattggagaaaaaacattccaacgttattgtgcagaattcatt
aaacattcacaacagataggtgatagttgggaatggagaccatcaaaggactgttctgat
ggctacatgtgcaaaatacactttcaaattaagaatgggtctgtgatgtcacatctagga
gcatctacccatggacagacatgtcttcccatggaggaggctttcgagctacccttggat
gattgtgaagtgattgaaactgcagcagcgtccgaagtgattaaatatgagtatcatgtc
ttatattcctgtagctaccaagtgcctgtactttactttagggcaagctttttagatggg
agacctttaactctgaaggacatatgggaaggagttcatgagtgctataagatgcgactg
ctacagggaccatgggacactattacgcaacaggaacatccaatacttgggcaacccttt
tttgtacttcatccctgcaagacgaatgaattcatgactcctgtattaaagaattctcag
aaaatcaataagaatgtcaactatatcacatcatggctgagcattgtagggccagttgtt
gggctgaatctacctctgagttatgccaaagcaacgtctcaggatgaacgaaatgtccct
taa

DBGET integrated database retrieval system