KEGG   Homo sapiens (human): 83740Help
Entry
83740             CDS       T01001                                 

Gene name
H2AFB3, H2ABBD, H2AFB
Definition
(RefSeq) H2A histone family member B3
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    83740 (H2AFB3)
 09160 Human Diseases
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    83740 (H2AFB3)
  09165 Substance dependence
   05034 Alcoholism
    83740 (H2AFB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    83740 (H2AFB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    83740 (H2AFB3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    83740 (H2AFB3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   83740 (H2AFB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone
Motif
Other DBs
NCBI-GeneID: 83740
NCBI-ProteinID: NP_542451
OMIM: 300445
HGNC: 14455
Ensembl: ENSG00000277745
Vega: OTTHUMG00000022670
Pharos: P0C5Z0(Tdark)
UniProt: P0C5Z0
Position
Xq28
AA seq 115 aa AA seqDB search
MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVI
EYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggaggaggagacgccgagggtcctccggtgctggcggccgggggcggacctgc
tctcgcaccgtccgagcggagctttcgttttcagtgagccaggtggagcgcagtctacgg
gagggccactacgctcagcgcctgagtcgcacggcgccggtctacctcgctgcggttatt
gagtacctgacggccaaggtcctggagctggcgggcaacgaggcccagaacagcggagag
cggaacatcactcccctgctgctggacatggtggttcacaacgacaggctactgagcacc
cttttcaacacgaccaccatctctcaagtggcccctggcgaggactag

DBGET integrated database retrieval system