KEGG   Homo sapiens (human): 83743
Entry
83743             CDS       T01001                                 

Gene name
GRWD1, CDW4, GRWD, RRB1, WDR28
Definition
(RefSeq) glutamate rich WD repeat containing 1
  KO
K14848  ribosome assembly protein RRB1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    83743 (GRWD1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    83743 (GRWD1)
SSDB
Motif
Pfam: WD40 CAF1C_H4-bd ANAPC4_WD40
Other DBs
NCBI-GeneID: 83743
NCBI-ProteinID: NP_113673
OMIM: 610597
HGNC: 21270
Ensembl: ENSG00000105447
Vega: OTTHUMG00000183305
Pharos: Q9BQ67(Tdark)
UniProt: Q9BQ67
Position
19q13.33
AA seq 446 aa
MAARKGRRRTCETGEPMEAESGDTSSEGPAQVYLPGRGPPLREGEELVMDEEAYVLYHRA
QTGAPCLSFDIVRDHLGDNRTELPLTLYLCAGTQAESAQSNRLMMLRMHNLHGTKPPPSE
GSDEEEEEEDEEDEEERKPQLELAMVPHYGGINRVRVSWLGEEPVAGVWSEKGQVEVFAL
RRLLQVVEEPQALAAFLRDEQAQMKPIFSFAGHMGEGFALDWSPRVTGRLLTGDCQKNIH
LWTPTDGGSWHVDQRPFVGHTRSVEDLQWSPTENTVFASCSADASIRIWDIRAAPSKACM
LTTATAHDGDVNVISWSRREPFLLSGGDDGALKIWDLRQFKSGSPVATFKQHVAPVTSVE
WHPQDSGVFAASGADHQITQWDLAVERDPEAGDVEADPGLADLPQQLLFVHQGETELKEL
HWHPQCPGLLVSTALSGFTIFRTISV
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggcggcgcgcaagggtcggcggcgcacgtgtgaaaccggggaacccatggaagccgag
tccggcgacacaagttccgagggcccggcccaggtctacctgcccggccgggggccgccg
ctacgcgaaggggaggagctggtcatggacgaggaggcctatgtgctctaccaccgagcg
cagactggcgccccctgtctcagctttgacatagtccgggatcacctgggagacaaccgg
acagagcttcctcttacactttacttgtgtgctgggacccaggctgagagcgcccagagc
aacagactgatgatgcttcggatgcacaatctgcatgggacaaagcccccaccctcagag
ggcagtgatgaagaagaagaggaggaagatgaagaggatgaagaagagcggaaacctcag
ctggagctggccatggtgccccactatggtggcatcaaccgagttcgggtgtcatggctg
ggtgaagagcctgtggctggggtgtggtcagagaagggccaggtggaggtgtttgcgctg
cggcggcttctgcaggtggtggaggagccccaggccctggcagccttcctccgggatgag
caggcccaaatgaagcccatcttctccttcgctggacacatgggcgagggctttgccctt
gactggtccccccgggtgaccggtcgcctgctgaccggtgactgtcaaaagaacatccac
ctctggacacctacggacggcggctcctggcacgtggaccagcggccattcgtgggccac
acacgctctgtggaggacctgcagtggtcaccgactgagaacacggtgtttgcctcctgc
tcagctgacgcctccatccgcatctgggacatccgggcagcccccagcaaggcctgcatg
ctcaccacagccaccgcccatgatggggacgtcaatgtcatcagctggagccgccgggag
cccttcctgctcagtggcggggatgatggggccctcaagatctgggaccttcggcagttc
aagtctggttccccagtggccaccttcaagcagcacgtggcccccgtgacctccgtcgag
tggcacccccaggacagcggggtctttgcagcctcgggtgcagaccaccagatcacacag
tgggacctggcagtggagcgggaccctgaggcgggcgacgtggaggccgaccccggactg
gccgacctcccgcagcagctgctgttcgtgcaccagggcgagaccgagctgaaggagctg
cactggcacccgcagtgcccagggctcctggtcagcacggcgctgtcaggcttcaccatc
ttccgcaccatcagcgtctga

DBGET integrated database retrieval system