KEGG   Homo sapiens (human): 83752
Entry
83752             CDS       T01001                                 

Gene name
LONP2, LONP, LONPL, PLON, PSLON
Definition
(RefSeq) lon peptidase 2, peroxisomal
  KO
K01338  ATP-dependent Lon protease [EC:3.4.21.53]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    83752 (LONP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.53  endopeptidase La
     83752 (LONP2)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S16: lon protease family
   83752 (LONP2)
SSDB
Motif
Pfam: Lon_C LON_substr_bdg AAA AAA_5 ChlI AAA_16 AAA_3 AAA_2 AAA_22 AAA_PrkA AAA_18 RsgA_GTPase RuvB_N SKI Rad17 AAA_33
Other DBs
NCBI-GeneID: 83752
NCBI-ProteinID: NP_113678
OMIM: 617774
HGNC: 20598
Ensembl: ENSG00000102910
Vega: OTTHUMG00000133144
Pharos: Q86WA8(Tbio)
UniProt: Q86WA8
Position
16q12.1
AA seq 852 aa
MSSVSPIQIPSRLPLLLTHEGVLLPGSTMRTSVDSARNLQLVRSRLLKGTSLQSTILGVI
PNTPDPASDAQDLPPLHRIGTAALAVQVVGSNWPKPHYTLLITGLCRFQIVQVLKEKPYP
IAEVEQLDRLEEFPNTCKMREELGELSEQFYKYAVQLVEMLDMSVPAVAKLRRLLDSLPR
EALPDILTSIIRTSNKEKLQILDAVSLEERFKMTIPLLVRQIEGLKLLQKTRKPKQDDDK
RVIAIRPIRRITHISGTLEDEDEDEDNDDIVMLEKKIRTSSMPEQAHKVCVKEIKRLKKM
PQSMPEYALTRNYLELMVELPWNKSTTDRLDIRAARILLDNDHYAMEKLKKRVLEYLAVR
QLKNNLKGPILCFVGPPGVGKTSVGRSVAKTLGREFHRIALGGVCDQSDIRGHRRTYVGS
MPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHNFTDHYLNVAF
DLSQVLFIATANTTATIPAALLDRMEIIQVPGYTQEEKIEIAHRHLIPKQLEQHGLTPQQ
IQIPQVTTLDIITRYTREAGVRSLDRKLGAICRAVAVKVAEGQHKEAKLDRSDVTEREGC
REHILEDEKPESISDTTDLALPPEMPILIDFHALKDILGPPMYEMEVSQRLSQPGVAIGL
AWTPLGGEIMFVEASRMDGEGQLTLTGQLGDVMKESAHLAISWLRSNAKKYQLTNAFGSF
DLLDNTDIHLHFPAGAVTKDGPSAGVTIVTCLASLFSGRLVRSDVAMTGEITLRGLVLPV
GGIKDKVLAAHRAGLKQVIIPRRNEKDLEGIPGNVRQDLSFVTASCLDEVLNAAFDGGFT
VKTRPGLLNSKL
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgtcatcagtgagccccatccagatccccagtcgcctcccgctgctgctcacccacgag
ggcgtcctgctgcccggctccaccatgcgcaccagcgtggactcggcccgcaacctgcag
ctggtgcggagccgccttctgaagggcacgtcgctgcaaagcaccatcctgggcgtcatc
cccaacacgcctgaccccgccagcgacgcgcaggacctgccgccgctgcacaggattggc
acagctgcactggccgttcaggttgtgggcagtaactggcccaagccccactacactctg
ttgattacaggcctatgccgtttccagattgtacaggtcttaaaagagaagccatatccc
attgctgaagtggagcagttggaccgacttgaggagtttcccaacacctgtaaaatgagg
gaggagctaggagaactatcagagcagttttacaaatatgcagtacaattggttgaaatg
ttggatatgtctgtccctgcagttgctaaattgagacgtcttttagatagtcttccaagg
gaagctttaccagacatcttgacatcaattatccgaacaagcaacaaagagaaactccag
attttagatgctgtgagcctagaggagcggttcaagatgactataccactgcttgtcaga
caaattgaaggcctgaaattgcttcaaaaaaccagaaaacccaagcaagatgatgataag
agggttatagcaatacgccctattaggagaattacacatatctcaggtactttagaagat
gaagatgaagatgaagataatgatgacattgtcatgctagagaaaaaaatacgaacatct
agtatgccagagcaggcccataaagtctgtgtcaaagagataaagagactcaaaaaaatg
cctcagtcaatgccagaatatgctctgactagaaattatttggaacttatggtagaactt
ccttggaacaaaagtacaactgaccgcctggacattagggcagcccggattcttctggat
aatgaccattacgccatggaaaaattgaagaaaagagtactggaatacttggctgtcaga
cagctcaaaaataacctgaagggcccaatcctatgctttgttggccctcctggagttggt
aaaacaagtgtgggaagatcagtggccaagactctaggtcgagagttccacaggattgca
cttggaggagtatgtgatcagtctgacattcgaggacacaggcgcacctatgttggcagc
atgcctggtcgcatcatcaacggcttgaagactgtgggagtgaacaacccagtgttccta
ttagatgaggttgacaaactgggaaaaagtctacagggtgatccagcagcagctctgctt
gaggtgttggatcctgaacaaaaccataacttcacagatcattatctaaatgtggccttt
gacctttctcaagttctttttatagctactgccaacaccactgctaccattccagctgcc
ttgttggacagaatggagatcattcaggttccaggttatacacaggaggagaagatagag
attgcccataggcacttgatccccaagcagctggaacaacatgggctgactccacagcag
attcagataccccaggtcaccactcttgacatcatcaccaggtataccagagaggcaggg
gttcgttctctggatagaaaacttggggccatttgccgagctgtggccgtgaaggtggca
gaaggacagcataaggaagccaagttggaccgttctgatgtgactgagagagaaggttgc
agagaacacatcttagaagatgaaaaacctgaatctatcagtgacactactgacttggct
ctaccacctgaaatgccgattttgattgatttccatgctctgaaagacatccttgggccc
ccgatgtatgaaatggaggtatctcagcgtttgagtcagccaggagtagcaataggtttg
gcttggactcccttaggtggagaaatcatgttcgtggaggcgagtcgaatggatggcgag
ggccagttaactctgaccggccagctcggggacgtgatgaaggagtccgcccacctcgct
atcagctggctccgcagcaacgcaaagaagtaccagctgaccaatgcttttggaagtttt
gatcttcttgacaacacagacatccatctgcacttcccagctggagctgtcacaaaagat
ggaccatctgctggagttaccatagtaacctgtctcgcctcactttttagtgggcggctg
gtacgttcagatgtagccatgactggagaaattacactgagaggtcttgttcttccagtg
ggtggaattaaagacaaagtgctggcggcacacagagcgggactgaagcaagtcattatt
cctcggagaaatgaaaaagaccttgagggaatcccaggcaacgtacgacaggatttaagt
tttgtcacagcaagctgcctggatgaggttcttaatgcagcttttgatggtggctttact
gtcaagaccagacctggtctgttaaatagcaaactgtag

DBGET integrated database retrieval system