KEGG   Homo sapiens (human): 83795
Entry
83795             CDS       T01001                                 

Gene name
KCNK16, K2p16.1, TALK-1, TALK1
Definition
(RefSeq) potassium two pore domain channel subfamily K member 16
  KO
K04924  potassium channel subfamily K member 16
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    83795 (KCNK16)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   83795 (KCNK16)
SSDB
Motif
Pfam: Ion_trans_2 Ion_trans DUF1580
Other DBs
NCBI-GeneID: 83795
NCBI-ProteinID: NP_115491
OMIM: 607369
HGNC: 14464
Ensembl: ENSG00000095981
Vega: OTTHUMG00000014645
Pharos: Q96T55(Tdark)
UniProt: Q96T55
Position
6p21.2
AA seq 309 aa
MPSAGLCSCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLENYTC
LDQWAMEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
GQVFCVFYALLGIPLNVIFLNHLGTGLRAHLAAIERWEDRPRRSQVLQVLGLALFLTLGT
LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI
LLGLAWLALILPLGPLLLHRCCQLWLLSLRQGCGAKAAPGRRPRRGSTAARGVQVTPQDF
PISKKGLGS
NT seq 930 nt   +upstreamnt  +downstreamnt
atgcccagtgctgggctctgcagctgctggggtggccgggtgctgcccctgctgctggcc
tatgtctgctacctgctgctcggtgccactatcttccagctgctagagaggcaggcggag
gctcagtccagggaccagtttcagttggagaagctgcgcttcctggagaactacacctgc
ctggaccagtgggccatggagcagtttgtgcaggtcatcatggaagcctgggtgaaaggt
gtgaaccccaaaggcaactctaccaaccccagcaactgggactttggcagcagtttcttc
tttgcaggcacagtcgtcactaccataggatatgggaacctggcacccagcacagaggca
ggtcaggtcttctgtgtcttctatgccctgttgggcatcccgcttaacgtgatcttcctc
aaccacctgggcacagggctgcgtgcccatctggccgccattgaaagatgggaggaccgt
cccaggcgctcccaggtactgcaagtcctgggcctggctctgttcctgaccctggggacg
ctggtcattctcatcttcccacccatggtcttcagccatgtggagggctggagcttcagc
gagggcttctactttgctttcatcactctcagcaccattggctttggggactatgttgtt
ggcacagaccccagcaagcattatatctcagtgtatcggagcctggcagccatctggatc
ctcctgggcctggcgtggctggcgctgatcctcccactgggccccctgcttctgcacaga
tgctgccagctctggctgctcagtctgaggcaaggctgtggagccaaggcggctccaggc
aggagacccaggagaggctctacagcagcaagaggagtccaagtcacaccccaggacttc
cccatatccaagaaaggactgggaagctga

DBGET integrated database retrieval system