KEGG   Homo sapiens (human): 838
Entry
838               CDS       T01001                                 

Gene name
CASP5, ICE(rel)III, ICEREL-III, ICH-3
Definition
(RefSeq) caspase 5
  KO
K04395  caspase 5 [EC:3.4.22.58]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05132  Salmonella infection
Network
nt06139  NLR signaling (viruses and bacteria)
  Element
N00934  Non-canonical inflammasome signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    838 (CASP5)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    838 (CASP5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    838 (CASP5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.58  caspase-5
     838 (CASP5)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C14: caspase family
   838 (CASP5)
SSDB
Motif
Pfam: Peptidase_C14 CARD DUF1338
Other DBs
NCBI-GeneID: 838
NCBI-ProteinID: NP_004338
OMIM: 602665
HGNC: 1506
Ensembl: ENSG00000137757
Vega: OTTHUMG00000048073
Pharos: P51878(Tchem)
UniProt: P51878
Position
11q22.3
AA seq 434 aa
MAEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVK
KDNHKKKTVKMLEYLGKDVLHGVFNYLAKHDVLTLKEEEKKKYYDTKIEDKALILVDSLR
KNRVAHQMFTQTLLNMDQKITSVKPLLQIEAGPPESAESTNILKLCPREEFLRLCKKNHD
EIYPIKKREDRRRLALIICNTKFDHLPARNGAHYDIVGMKRLLQGLGYTVVDEKNLTARD
MESVLRAFAARPEHKSSDSTFLVLMSHGILEGICGTAHKKKKPDVLLYDTIFQIFNNRNC
LSLKDKPKVIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFIAF
CSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIE
RATLTRDFYLFPGN
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggctgaagacagtggcaaaaaaaaaaggcgtaagaattttgaagctatgttcaaaggt
atccttcagagtggattggataacttcgtgataaaccacatgctaaagaacaacgtggct
ggacaaacatctatccagaccctagtacctaatacggatcaaaagtcgaccagtgtaaaa
aaagacaaccacaaaaaaaaaacagttaagatgttggaatacctgggcaaagatgttctt
catggtgtttttaattatttggcaaaacacgatgttctgacattgaaggaagaggaaaag
aaaaaatattatgataccaaaattgaagacaaggccctgatcttggtagactctttgcga
aagaatcgcgtggctcatcaaatgtttacccaaacacttctcaatatggaccaaaagatc
accagtgtaaaacctcttctgcaaatcgaggctggaccacctgagtcagcagaatctaca
aatatactcaaactttgtcctcgtgaagaattcctgagactgtgtaaaaaaaatcatgat
gagatctatccaataaaaaagagagaggaccgcagacgcctggctctcatcatatgcaat
acaaagtttgatcacctgcctgcaaggaatggggctcactatgacatcgtggggatgaaa
aggctgcttcaaggcctgggctacactgtggttgacgaaaagaatctcacagccagggat
atggagtcagtgctgagggcatttgctgccagaccagagcacaagtcctctgacagcacg
ttcttggtactcatgtctcatggcatcctagagggaatctgcggaactgcgcataaaaag
aaaaaaccggatgtgctgctttatgacaccatcttccagatattcaacaaccgcaactgc
ctcagtctaaaggacaaacccaaggtcatcattgtccaggcctgcagaggtgaaaaacat
ggggaactctgggtcagagactctccagcatccttggcactcatctcttcacagtcatct
gagaacctggaggcagattctgtttgcaagatccacgaggagaaggacttcattgctttc
tgttcttcaacaccacataacgtgtcctggagagaccgcacaaggggctccatcttcatt
acggaactcatcacatgcttccagaaatattcttgctgctgccacctaatggaaatattt
cggaaggtacagaaatcatttgaagttccacaggctaaagcccagatgcccaccatagaa
cgagcaaccttgacaagagatttctacctctttcctggcaattga

DBGET integrated database retrieval system