KEGG   Homo sapiens (human): 8382
Entry
8382              CDS       T01001                                 

Gene name
NME5, NM23-H5, NM23H5, RSPH23
Definition
(RefSeq) NME/NM23 family member 5
  KO
K20790  nucleoside diphosphate kinase homolog 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8382 (NME5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    8382 (NME5)
SSDB
Motif
Pfam: NDK Dpy-30 RIIa
Other DBs
NCBI-GeneID: 8382
NCBI-ProteinID: NP_003542
OMIM: 603575
HGNC: 7853
Ensembl: ENSG00000112981
Vega: OTTHUMG00000129207
Pharos: P56597(Tbio)
UniProt: P56597 A0A0S2Z4L9
Position
5q31.2
AA seq 212 aa
MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVE
KYGKMFFPNLTAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTD
DLRNALHGSNDFAAAEREIRFMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQK
PADPLIWLADWLLKNNPNKPKLCHHPIVEEPY
NT seq 639 nt   +upstreamnt  +downstreamnt
atggagatatcaatgcctccacctcagatatatgtagaaaaaactctggccattatcaaa
ccagatattgttgacaaagaggaggagatacaagatattattcttagatccggattcacc
attgttcagagaagaaaactacgcctcagccctgagcaatgtagtaacttttatgtggaa
aagtatggaaaaatgtttttccccaacttaacagcttacatgagttctggaccacttgtc
gccatgatattagctagacataaagccatctcttattggttagaacttttgggaccaaat
aatagcttagtagcgaaggagacacatccagacagtctgagggcaatttatggcacagat
gacctaaggaatgcacttcatgggagtaatgactttgctgctgcggaaagagaaatacgt
tttatgtttcctgaagtgattgttgagcccattccaattggacaagctgctaaggactat
ttaaatttacatataatgccaactctgcttgaaggactcacagagctttgtaagcaaaaa
ccagcagatcctttgatttggctagctgattggctgctgaaaaataatcctaacaaaccc
aaactttgtcaccatccaattgtagaagaaccttattaa

DBGET integrated database retrieval system