KEGG   Homo sapiens (human): 8383
Entry
8383              CDS       T01001                                 

Gene name
OR1A1, OR17-7
Definition
(RefSeq) olfactory receptor family 1 subfamily A member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    8383 (OR1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8383 (OR1A1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    8383 (OR1A1)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 8383
NCBI-ProteinID: NP_055380
OMIM: 618046
HGNC: 8179
Ensembl: ENSG00000172146
Vega: OTTHUMG00000090637
Pharos: Q9P1Q5(Tdark)
UniProt: Q9P1Q5 A0A126GWA2
Position
17p13.3
AA seq 309 aa
MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMY
FLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAY
DRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCD
ITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTC
GSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALR
KLFNKRISS
NT seq 930 nt   +upstreamnt  +downstreamnt
atgagggaaaataaccagtcctctacactggaattcatcctcctgggagttactggtcag
caggaacaggaagatttcttctacatcctcttcttgttcatttaccccatcacattgatt
ggaaacctgctcatcgtcctagccatttgctctgatgttcgccttcacaaccccatgtat
tttctccttgccaacctctccttggttgacatcttcttctcatcggtaaccatccctaag
atgctggccaaccatctcttgggcagcaaatccatctcttttgggggatgcctaacgcag
atgtatttcatgatagccttgggtaacacagacagctatattttggctgcaatggcatat
gatcgagctgtggccatcagccgcccacttcactacacaacaattatgagtccacggtct
tgtatctggcttattgctgggtcttgggtgattggaaatgccaatgccctcccccacact
ctgctcacagctagtctgtccttctgtggcaaccaggaagtggccaacttctactgtgac
attacccccttgctgaagttatcctgttctgacatccactttcatgtgaagatgatgtac
ctaggggttggcattttctctgtgccattactatgcatcattgtctcctatattcgagtc
ttctccacagtcttccaggttccttccaccaagggcgtgctcaaggccttctccacctgt
ggttcccacctcacggttgtctctttgtattatggtacagtcatgggcacgtatttccgc
cctttgaccaattatagcctaaaagacgcagtgatcactgtaatgtacacggcagtgacc
ccaatgttaaatcctttcatctacagtctgagaaatcgggacatgaaggctgccctgcgg
aaactcttcaacaagagaatctcctcgtaa

DBGET integrated database retrieval system