KEGG   Homo sapiens (human): 83851Help
Entry
83851             CDS       T01001                                 

Gene name
SYT16, CHR14SYT, SYT14L, Strep14, syt14r
Definition
(RefSeq) synaptotagmin 16
  KO
K19328  synaptotagmin-14/16
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    83851 (SYT16)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    83851 (SYT16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2
Motif
Other DBs
NCBI-GeneID: 83851
NCBI-ProteinID: NP_001354579
OMIM: 610950
HGNC: 23142
Ensembl: ENSG00000139973
Vega: OTTHUMG00000171106
Pharos: Q17RD7(Tdark)
Position
14q23.2
AA seq 339 aa AA seqDB search
METAFNSRGFEDSYATDSSSMWSPEEQDRTNLQVPSGVSEPISKCGDLDVIFEYRAASQK
LTVTIVRAQGLPDKDRSGVNSWQVHVVLLPGKKHRGRTNIQRGPNPVFREKVTFAKLEPR
DVAACAVRFRLYAARKMTRERMMGEKLFYLSHLHPEGEMKVTLVLEPRSNISSGGSPLSP
SAVSHSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGK
LFLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEM
IGWIALGQNSSGEEEQDHWEEMKETKGQQICRWHTLLES
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggagacagcttttaatagccggggatttgaagattcctatgccactgacagctcctcc
atgtggagtccagaggaacaggacaggaccaatttgcaggtgccatccggggtctcagag
cccatctcaaagtgtggtgacctagatgtcatctttgaatatagagccgccagccagaag
ctcacagtgaccattgtgagggcacagggcctcccagataaggaccgaagtggtgtcaac
tcctggcaagttcatgtagtgctgctgcctggtaagaaacacaggggcaggacgaacata
cagagagggcccaaccccgtcttcagggagaaggtcacctttgccaagctggagcccaga
gatgtggctgcctgtgctgtccgcttccgcctgtacgctgcccggaagatgacccgagag
agaatgatgggagagaaactattctatctcagccacctgcacccagaaggggaaatgaaa
gtgactctggttctggagccaagaagtaatataagcagtggagggtctccgctcagccca
tctgcggtttctcacagtgatagtacttcatccacgcagtcgctgtctcatggaggggcg
ccagagctgttggtggggctctcgtacaatgccacaacggggcgattatctgtggaaatg
atcaaaggcagccatttccgaaacctcgctgttaaccgagcacctgatacatatggaaaa
ctctttctcctcaattctgtgggtcaagagatgtcccgttgcaagacgtccattcggcgt
ggtcagcccaatcctgtctataaggagacctttgttttccaggtggccctctttcagctg
tctgatgtcacgttgatgatttccgtttataacaggcgtactatgaagcgtaaagagatg
attggctggattgccctgggccagaacagcagtggagaggaggaacaagatcactgggag
gagatgaaggaaaccaaaggccagcagatctgcagatggcacactttgctggaatcctag

DBGET integrated database retrieval system