KEGG   Homo sapiens (human): 83858
Entry
83858             CDS       T01001                                 

Gene name
ATAD3B, AAA-TOB3, TOB3
Definition
(RefSeq) ATPase family AAA domain containing 3B
  KO
K17681  ATPase family AAA domain-containing protein 3A/B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    83858 (ATAD3B)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    83858 (ATAD3B)
SSDB
Motif
Pfam: DUF3523 AAA RuvB_N AAA_16 AAA_24 AAA_22 ATPase Zot AAA_18 AAA_lid_3 AAA_5 TsaE Mg_chelatase RNA_helicase AAA_33 AAA_3 AAA_25 AAA_7
Other DBs
NCBI-GeneID: 83858
NCBI-ProteinID: NP_114127
OMIM: 612317
HGNC: 24007
Ensembl: ENSG00000160072
Vega: OTTHUMG00000000577
Pharos: Q5T9A4(Tbio)
UniProt: Q5T9A4
Position
1p36.33
AA seq 648 aa
MSWLFGVNKGPKGEGAGPPPPLPPAQPGAEGGGDRGLGDRPAPKDKWSNFDPTGLERAAK
AARELEHSRYAKEALNLAQMQEQTLQLEQQSKLKEYEAAVEQLKSEQIRAQAEERRKTLS
EETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAMRRATVEREMEL
RHKNEMLRVETEARARAKAERENADIIREQIRLKASEHRQTVLESIRTAGTLFGEGFRAF
VTDRDKVTATVAGLTLLAVGVYSAKNATAVTGRFIEARLGKPSLVRETSRITVLEALRHP
IQVSRRLLSRPQDVLEGVVLSPSLEARVRDIAIATRNTKKNRGLYRHILLYGPPGTGKTL
FAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFMDEADAFLRKR
ATEEISKDLRATLNAFLYHMGQHSNKFMLVLASNLPEQFDCAINSRIDVMVHFDLPQQEE
RERLVRLHFDNCVLKPATEGKRRLKLAQFDYGRKCSEVARLTEGMSGREIAQLAVSWQAT
AYASKDGVLTEAMMDACVQDAVQQYRQKMRWLKAEGPGRGVEHPLSGVQGETLTSWSLAT
DPSYPCLAGPCTFRICSWMGTGLCPGPLSPRMSCGGGRPFCPPGHPLL
NT seq 1947 nt   +upstreamnt  +downstreamnt
atgtcgtggctcttcggcgttaacaagggccccaagggtgaaggcgcggggccgccgccg
cctttgccgcccgcgcagcccggggccgagggcggcggggaccgcggtttgggagaccgg
ccggcgcccaaggacaaatggagcaacttcgaccccaccggcctggagcgcgccgccaag
gcggcgcgcgagctggagcactcgcgttacgccaaggaggccctgaatctggcgcagatg
caggagcagacgctgcagttggagcaacagtccaagctcaaagagtatgaggccgccgtg
gagcagctcaagagcgagcagatccgggcgcaggctgaggagaggaggaagaccctgagc
gaggagacccggcagcaccaggccagggcccagtatcaagacaagctggcccggcagcgc
tacgaggaccaactgaagcagcagcaacttctcaatgaggagaatttacggaagcaggag
gagtccgtgcagaagcaggaagccatgcggcgagccaccgtggagcgggagatggagctg
cggcacaagaatgagatgctgcgagtggagaccgaggcccgggcgcgcgccaaggccgag
cgggagaatgcagacatcatccgcgagcagatccgcctgaaggcgtccgagcaccgtcag
accgtcttggagtccatcaggacggctggcaccttgtttggggaaggattccgtgccttt
gtgacagaccgggacaaagtgacagccacggtggctgggctgacgctgctggctgtcggg
gtctactcagccaagaatgcgacagccgtcactggccgcttcatcgaggctcggctgggg
aagccgtccctagtgagggagacgtcccgcatcacggtgctggaggcgctgcggcacccc
atccaggtcagccggcggctcctcagtcgaccccaggacgtgctggagggtgttgtgctt
agtcccagcctggaagcacgggtgcgcgacatcgccatagcaaccaggaacaccaagaag
aaccggggcctgtacaggcacatcctgctgtatgggccaccaggcaccgggaagacgctg
tttgccaagaaactcgccctgcactcaggcatggactacgccatcatgacaggcggggac
gtggcccccatggggcgggaaggcgtgaccgccatgcacaagctctttgactgggccaat
accagccggcgcggcctcctgctcttcatggatgaagcagacgccttccttcggaagcga
gccactgaggagataagcaaggacctcagagccacactgaacgccttcctgtaccacatg
ggccaacacagcaacaaattcatgctggtcctggccagcaatctgcctgagcagttcgac
tgtgccatcaacagccgcattgacgtgatggtccacttcgacctgccgcagcaggaggag
cgggagcgcctggtgagactgcattttgacaactgtgttcttaagccggccacagaagga
aaacggcgcctgaagctggcccagtttgactacgggaggaagtgctcggaggtcgctcgg
ctgacggagggcatgtcgggccgggagatcgctcagctggccgtgtcctggcaggccacg
gcatatgcctccaaggacggggtcctcactgaggccatgatggacgcctgtgtgcaagat
gctgtccagcagtaccgacagaagatgcgctggctgaaggcggaggggcctgggcgcggg
gtcgagcaccccctatccggagtccaaggcgagaccctcacctcatggagcctggccacg
gacccctcctacccctgccttgccggcccctgcacatttaggatatgctcctggatgggg
actgggctgtgcccagggcctctgtcccccaggatgtcttgtggtggcggtcggccgttc
tgccccccagggcaccccctgttgtag

DBGET integrated database retrieval system